Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MKF36_RS11715 Genome accession   NZ_CP092750
Coordinates   2403764..2403937 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain KS04AU     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2398764..2408937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MKF36_RS11700 (MKF36_11700) gcvT 2399577..2400677 (-) 1101 WP_042635355.1 glycine cleavage system aminomethyltransferase GcvT -
  MKF36_RS11705 (MKF36_11705) - 2401101..2402771 (+) 1671 WP_031378948.1 SNF2-related protein -
  MKF36_RS11710 (MKF36_11710) - 2402793..2403587 (+) 795 WP_007408330.1 YqhG family protein -
  MKF36_RS11715 (MKF36_11715) sinI 2403764..2403937 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  MKF36_RS11720 (MKF36_11720) sinR 2403971..2404306 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  MKF36_RS11725 (MKF36_11725) - 2404354..2405139 (-) 786 WP_007408329.1 TasA family protein -
  MKF36_RS11730 (MKF36_11730) - 2405204..2405788 (-) 585 WP_007408328.1 signal peptidase I -
  MKF36_RS11735 (MKF36_11735) tapA 2405760..2406431 (-) 672 WP_042635356.1 amyloid fiber anchoring/assembly protein TapA -
  MKF36_RS11740 (MKF36_11740) - 2406690..2407019 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  MKF36_RS11745 (MKF36_11745) - 2407059..2407238 (-) 180 WP_003153093.1 YqzE family protein -
  MKF36_RS11750 (MKF36_11750) comGG 2407295..2407672 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  MKF36_RS11755 (MKF36_11755) comGF 2407673..2408173 (-) 501 WP_262982688.1 competence type IV pilus minor pilin ComGF -
  MKF36_RS11760 (MKF36_11760) comGE 2408082..2408396 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  MKF36_RS11765 (MKF36_11765) comGD 2408380..2408817 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=660026 MKF36_RS11715 WP_003153105.1 2403764..2403937(+) (sinI) [Bacillus velezensis strain KS04AU]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=660026 MKF36_RS11715 WP_003153105.1 2403764..2403937(+) (sinI) [Bacillus velezensis strain KS04AU]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702