Detailed information NTG0658236

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: LU695_RS20255
• Genome accession: NZ_CP092500
• Coordinates: 4059943..4060479 (-)
• Length: 178 a.a.
• NCBI ID: WP_000168305.1
• Uniprot ID: A0A9P2PPK2
• Organism: Escherichia coli strain A30
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4050753..4066756	4059943..4060479	within	0

Gene organization within MGE regions

Location: 4050753..4066756

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LU695_RS20210 (LU695_20200)	yjcF	4050753..4052046 (+)	1294	Protein_3968	pentapeptide repeat-containing protein	-
LU695_RS20215 (LU695_20205)	yjcE	4052200..4053849 (-)	1650	WP_000402207.1	Na+/H+ antiporter	-
LU695_RS20220 (LU695_20210)	ghxP	4054000..4055349 (-)	1350	WP_000106882.1	guanine/hypoxanthine transporter GhxP	-
LU695_RS20225 (LU695_20215)	soxR	4055895..4056359 (-)	465	WP_000412428.1	redox-sensitive transcriptional activator SoxR	-
LU695_RS20230 (LU695_20220)	soxS	4056445..4056768 (+)	324	WP_000019358.1	superoxide response transcriptional regulator SoxS	-
LU695_RS20235 (LU695_20225)	pdeC	4056771..4057493 (-)	723	Protein_3973	c-di-GMP phosphodiesterase PdeC	-
LU695_RS20245 (LU695_20235)	pdeC	4058258..4059133 (-)	876	Protein_3975	c-di-GMP phosphodiesterase PdeC	-
LU695_RS20250 (LU695_20240)	yjcB	4059563..4059844 (+)	282	WP_001295689.1	YjcB family protein	-
LU695_RS20255 (LU695_20245)	ssb	4059943..4060479 (-)	537	WP_000168305.1	single-stranded DNA-binding protein SSB1	Machinery gene
LU695_RS20260 (LU695_20250)	uvrA	4060733..4063555 (+)	2823	WP_000357740.1	excinuclease ABC subunit UvrA	-
LU695_RS20265 (LU695_20255)	yjbR	4063590..4063946 (-)	357	WP_000155657.1	MmcQ/YjbR family DNA-binding protein	-
LU695_RS20270 (LU695_20260)	yjbQ	4063950..4064366 (-)	417	WP_000270375.1	secondary thiamine-phosphate synthase enzyme YjbQ	-
LU695_RS20275 (LU695_20265)	aphA	4064477..4065190 (-)	714	WP_001226928.1	acid phosphatase AphA	-
LU695_RS20280 (LU695_20270)	-	4065356..4066053 (+)	698	WP_103215986.1	IS1-like element IS1A family transposase	-
LU695_RS20285 (LU695_20275)	-	4066370..4066756 (+)	387	WP_001346065.1	hypothetical protein	-

Sequence

Protein

• Length: 178 a.a.
• Molecular weight: 18975.00 Da
• Isoelectric Point: 5.2358

>NTDB_id=658236 LU695_RS20255 WP_000168305.1 4059943..4060479(-) (ssb) [Escherichia coli strain A30]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF

Nucleotide

• Length: 537 bp

>NTDB_id=658236 LU695_RS20255 WP_000168305.1 4059943..4060479(-) (ssb) [Escherichia coli strain A30]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGTAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (6-112)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Vibrio cholerae strain A1552	74.444	100	0.753
ssb	Glaesserella parasuis strain SC1401	57.923	100	0.596
ssb	Neisseria meningitidis MC58	48.066	100	0.489
ssb	Neisseria gonorrhoeae MS11	48.066	100	0.489