Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | MKD48_RS03830 | Genome accession | NZ_CP092475 |
| Coordinates | 756250..756720 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610647.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain P5 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 730636..787363 | 756250..756720 | within | 0 |
Gene organization within MGE regions
Location: 730636..787363
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MKD48_RS03655 | groES | 730636..730920 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| MKD48_RS03660 | groL | 730996..732612 (+) | 1617 | WP_000240649.1 | chaperonin GroEL | - |
| MKD48_RS03665 | - | 732707..733253 (-) | 547 | Protein_719 | site-specific integrase | - |
| MKD48_RS03670 | - | 733314..733526 (+) | 213 | WP_000128898.1 | hypothetical protein | - |
| MKD48_RS03675 | - | 733523..734113 (+) | 591 | WP_001293059.1 | terminase small subunit | - |
| MKD48_RS03680 | - | 734430..734867 (+) | 438 | WP_075583719.1 | hypothetical protein | - |
| MKD48_RS03685 | - | 734973..735416 (+) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| MKD48_RS03690 | - | 736259..737566 (-) | 1308 | WP_248313599.1 | TrkH family potassium uptake protein | - |
| MKD48_RS03695 | - | 737727..738638 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| MKD48_RS03700 | - | 738700..739545 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| MKD48_RS03705 | - | 739917..741140 (-) | 1224 | WP_000206641.1 | ArgE/DapE family deacylase | - |
| MKD48_RS03710 | lukH | 741575..742627 (+) | 1053 | WP_000791416.1 | bi-component leukocidin LukGH subunit H | - |
| MKD48_RS03715 | lukG | 742649..743665 (+) | 1017 | WP_000595402.1 | bi-component leukocidin LukGH subunit G | - |
| MKD48_RS03720 | sph | 743903..744733 (-) | 831 | Protein_730 | sphingomyelin phosphodiesterase | - |
| MKD48_RS03725 | - | 744784..745821 (-) | 1038 | WP_000857198.1 | site-specific integrase | - |
| MKD48_RS03730 | - | 746012..746725 (-) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| MKD48_RS03735 | - | 746803..746985 (-) | 183 | WP_000705236.1 | hypothetical protein | - |
| MKD48_RS03740 | - | 747056..747241 (-) | 186 | WP_000109189.1 | hypothetical protein | - |
| MKD48_RS03745 | - | 747238..747384 (-) | 147 | WP_000345949.1 | hypothetical protein | - |
| MKD48_RS03750 | - | 747458..748312 (-) | 855 | WP_001557601.1 | HIRAN domain-containing protein | - |
| MKD48_RS03755 | - | 748324..749040 (-) | 717 | WP_001083975.1 | LexA family transcriptional regulator | - |
| MKD48_RS03760 | - | 749204..749446 (+) | 243 | WP_000639923.1 | DUF739 family protein | - |
| MKD48_RS03765 | - | 749459..749905 (+) | 447 | WP_000435349.1 | hypothetical protein | - |
| MKD48_RS03770 | - | 749920..750060 (+) | 141 | WP_000939495.1 | hypothetical protein | - |
| MKD48_RS03775 | - | 750053..750262 (-) | 210 | WP_000772137.1 | hypothetical protein | - |
| MKD48_RS03780 | - | 750319..751068 (+) | 750 | WP_001148590.1 | phage antirepressor KilAC domain-containing protein | - |
| MKD48_RS03785 | - | 751081..751341 (+) | 261 | WP_000435343.1 | hypothetical protein | - |
| MKD48_RS03790 | - | 751365..751520 (-) | 156 | Protein_744 | hypothetical protein | - |
| MKD48_RS03795 | - | 751574..751894 (+) | 321 | WP_001120936.1 | DUF771 domain-containing protein | - |
| MKD48_RS03800 | - | 751891..752052 (+) | 162 | WP_000066011.1 | DUF1270 domain-containing protein | - |
| MKD48_RS03805 | - | 752145..752405 (+) | 261 | WP_000291488.1 | DUF1108 family protein | - |
| MKD48_RS03810 | - | 752414..752677 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| MKD48_RS03815 | - | 752686..754629 (+) | 1944 | WP_000700571.1 | AAA family ATPase | - |
| MKD48_RS03820 | - | 754631..755551 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| MKD48_RS03825 | - | 755632..756249 (+) | 618 | WP_072528355.1 | MBL fold metallo-hydrolase | - |
| MKD48_RS03830 | ssbA | 756250..756720 (+) | 471 | WP_000610647.1 | single-stranded DNA-binding protein | Machinery gene |
| MKD48_RS03835 | - | 756750..757667 (+) | 918 | WP_041497902.1 | DnaD domain protein | - |
| MKD48_RS03840 | - | 757674..757892 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| MKD48_RS03845 | - | 757901..758305 (+) | 405 | WP_000401966.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MKD48_RS03850 | - | 758318..758686 (+) | 369 | WP_000101270.1 | SA1788 family PVL leukocidin-associated protein | - |
| MKD48_RS03855 | - | 758690..758932 (+) | 243 | WP_000131377.1 | phi PVL orf 51-like protein | - |
| MKD48_RS03860 | - | 758946..759332 (+) | 387 | WP_000693615.1 | hypothetical protein | - |
| MKD48_RS03865 | - | 759329..759523 (+) | 195 | WP_000983954.1 | hypothetical protein | - |
| MKD48_RS03870 | - | 759520..759969 (+) | 450 | WP_000982708.1 | YopX family protein | - |
| MKD48_RS03875 | - | 759966..760250 (+) | 285 | WP_001105621.1 | hypothetical protein | - |
| MKD48_RS03880 | - | 760243..760497 (+) | 255 | WP_001065084.1 | DUF1024 family protein | - |
| MKD48_RS03885 | - | 760484..760654 (+) | 171 | WP_000714409.1 | hypothetical protein | - |
| MKD48_RS03890 | - | 760647..761180 (+) | 534 | WP_000185642.1 | dUTP pyrophosphatase | - |
| MKD48_RS03895 | - | 761217..761504 (+) | 288 | WP_000195809.1 | DUF1381 domain-containing protein | - |
| MKD48_RS03900 | - | 761497..761733 (+) | 237 | WP_000608280.1 | hypothetical protein | - |
| MKD48_RS03905 | - | 761723..762112 (+) | 390 | WP_170267442.1 | hypothetical protein | - |
| MKD48_RS03910 | - | 762109..762258 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| MKD48_RS03915 | - | 762258..762458 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| MKD48_RS03920 | - | 762486..762902 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| MKD48_RS03925 | - | 763134..763433 (+) | 300 | WP_000988333.1 | HNH endonuclease | - |
| MKD48_RS03930 | - | 763564..763908 (+) | 345 | WP_103246369.1 | hypothetical protein | - |
| MKD48_RS03935 | - | 763905..765566 (+) | 1662 | WP_000625086.1 | terminase large subunit | - |
| MKD48_RS03940 | - | 765582..766745 (+) | 1164 | WP_000025268.1 | phage portal protein | - |
| MKD48_RS03945 | - | 766729..767406 (+) | 678 | WP_248313598.1 | head maturation protease, ClpP-related | - |
| MKD48_RS03950 | - | 767489..768634 (+) | 1146 | WP_000154567.1 | phage major capsid protein | - |
| MKD48_RS03955 | - | 768654..768938 (+) | 285 | WP_000238240.1 | hypothetical protein | - |
| MKD48_RS03960 | - | 768928..769212 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| MKD48_RS03965 | - | 769196..769558 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| MKD48_RS03970 | - | 769555..769959 (+) | 405 | WP_000114341.1 | HK97 gp10 family phage protein | - |
| MKD48_RS03975 | - | 769956..770363 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| MKD48_RS03980 | - | 770364..771005 (+) | 642 | WP_000985141.1 | major tail protein | - |
| MKD48_RS03985 | - | 771322..771672 (+) | 351 | WP_001096355.1 | hypothetical protein | - |
| MKD48_RS03990 | - | 771723..771860 (+) | 138 | WP_001549167.1 | hypothetical protein | - |
| MKD48_RS03995 | - | 771917..776446 (+) | 4530 | WP_014667731.1 | phage tail tape measure protein | - |
| MKD48_RS04000 | - | 776443..777927 (+) | 1485 | WP_000567389.1 | phage tail domain-containing protein | - |
| MKD48_RS04005 | - | 777943..781728 (+) | 3786 | WP_000582168.1 | phage tail spike protein | - |
| MKD48_RS04010 | - | 781718..781870 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| MKD48_RS04015 | - | 781917..782204 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| MKD48_RS04020 | - | 782262..782558 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| MKD48_RS04025 | pepG1 | 782750..782884 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| MKD48_RS04030 | - | 782937..783044 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| MKD48_RS04035 | - | 783096..783350 (+) | 255 | WP_000611512.1 | phage holin | - |
| MKD48_RS04040 | - | 783362..784117 (+) | 756 | WP_000861039.1 | CHAP domain-containing protein | - |
| MKD48_RS04045 | sak | 784308..784799 (+) | 492 | WP_000919349.1 | staphylokinase | - |
| MKD48_RS04050 | - | 785449..785784 (+) | 336 | Protein_796 | SH3 domain-containing protein | - |
| MKD48_RS04055 | - | 785879..786328 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| MKD48_RS04060 | scn | 787013..787363 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=657885 MKD48_RS03830 WP_000610647.1 756250..756720(+) (ssbA) [Staphylococcus aureus strain P5]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=657885 MKD48_RS03830 WP_000610647.1 756250..756720(+) (ssbA) [Staphylococcus aureus strain P5]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGCAGATTACAAACGCGT
AACTATGAAAACAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAGTTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGCAGATTACAAACGCGT
AACTATGAAAACAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAGTTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |