Detailed information    

insolico Bioinformatically predicted

Overview

Name   comZ   Type   Machinery gene
Locus tag   MI302_RS04580 Genome accession   NZ_CP092445
Coordinates   736145..736330 (-) Length   61 a.a.
NCBI ID   WP_239726349.1    Uniprot ID   -
Organism   Thermus sp. NEB1569     
Function   assembly of type IV pilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 731145..741330
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MI302_RS04545 (MI302_04545) trpS 731713..732726 (+) 1014 WP_239726345.1 tryptophan--tRNA ligase -
  MI302_RS04550 (MI302_04550) - 732723..733379 (+) 657 WP_239726346.1 chromosome segregation protein ScpA -
  MI302_RS04555 (MI302_04555) - 733395..733949 (+) 555 WP_239726347.1 Uma2 family endonuclease -
  MI302_RS04560 (MI302_04560) - 733969..734229 (-) 261 WP_239726348.1 hypothetical protein -
  MI302_RS04565 (MI302_04565) - 734290..734796 (-) 507 WP_008633626.1 IS630 family transposase -
  MI302_RS04570 (MI302_04570) - 734835..735362 (-) 528 WP_019551665.1 winged helix-turn-helix domain-containing protein -
  MI302_RS04575 (MI302_04575) - 735573..735932 (-) 360 WP_126204502.1 prepilin-type N-terminal cleavage/methylation domain-containing protein -
  MI302_RS04580 (MI302_04580) comZ 736145..736330 (-) 186 WP_239726349.1 hypothetical protein Machinery gene
  MI302_RS04585 (MI302_04585) - 736332..737075 (-) 744 WP_135260897.1 transposase -
  MI302_RS04590 (MI302_04590) comZ 737024..738907 (-) 1884 WP_239726350.1 pilus assembly PilX N-terminal domain-containing protein Machinery gene
  MI302_RS04595 (MI302_04595) pilA/pilA3 738918..739619 (-) 702 WP_239726351.1 PilW family protein Machinery gene
  MI302_RS04600 (MI302_04600) pilA/pilA2 739637..740224 (-) 588 WP_239726352.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  MI302_RS04605 (MI302_04605) - 740221..740694 (-) 474 WP_239726353.1 GspH/FimT family protein -
  MI302_RS04610 (MI302_04610) pilA/pilA1 740748..741218 (-) 471 WP_239726354.1 GspH/FimT family protein Machinery gene

Sequence

Protein


Download         Length: 61 a.a.        Molecular weight: 7014.01 Da        Isoelectric Point: 9.6877

>NTDB_id=657519 MI302_RS04580 WP_239726349.1 736145..736330(-) (comZ) [Thermus sp. NEB1569]
MSTQVNIRKGGNKNEEKEDQCNAGQKAEVVYIRIPKENRPALLPDLKEGKPVFQVLSYERR

Nucleotide


Download         Length: 186 bp        

>NTDB_id=657519 MI302_RS04580 WP_239726349.1 736145..736330(-) (comZ) [Thermus sp. NEB1569]
GTGAGTACGCAGGTGAATATCCGAAAAGGGGGTAATAAGAACGAGGAGAAGGAAGACCAATGCAACGCCGGCCAGAAGGC
CGAGGTGGTCTATATCCGCATCCCCAAGGAAAACCGCCCGGCCTTGCTGCCGGACCTTAAGGAGGGTAAGCCCGTCTTCC
AGGTGCTCTCCTATGAGCGCCGCTAG

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comZ Thermus thermophilus HB27

67.213

100

0.672