Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MJO57_RS28900 | Genome accession | NZ_CP092417 |
| Coordinates | 6421289..6421801 (+) | Length | 170 a.a. |
| NCBI ID | WP_252020718.1 | Uniprot ID | - |
| Organism | Endozoicomonas sp. SCSIO W0465 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 6376127..6421801 | 6421289..6421801 | within | 0 |
Gene organization within MGE regions
Location: 6376127..6421801
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MJO57_RS28645 (MJO57_28530) | - | 6376127..6377353 (+) | 1227 | WP_252020638.1 | ISL3 family transposase | - |
| MJO57_RS28650 (MJO57_28535) | - | 6377376..6377864 (+) | 489 | WP_252018121.1 | transposase | - |
| MJO57_RS28655 (MJO57_28540) | - | 6377833..6378315 (+) | 483 | WP_252026893.1 | IS1595 family transposase | - |
| MJO57_RS28660 (MJO57_28545) | - | 6378285..6378725 (-) | 441 | WP_252020640.1 | hypothetical protein | - |
| MJO57_RS33520 | - | 6378897..6379055 (-) | 159 | WP_371924926.1 | transposase | - |
| MJO57_RS28665 (MJO57_28550) | - | 6379067..6380383 (-) | 1317 | Protein_5742 | IS1182 family transposase | - |
| MJO57_RS28670 (MJO57_28555) | - | 6380709..6381068 (+) | 360 | WP_252020643.1 | SDR family oxidoreductase | - |
| MJO57_RS28675 (MJO57_28560) | phaR | 6381078..6381518 (-) | 441 | WP_066016645.1 | polyhydroxyalkanoate synthesis repressor PhaR | - |
| MJO57_RS28685 (MJO57_28570) | phaC | 6382949..6384733 (-) | 1785 | WP_252020647.1 | class I poly(R)-hydroxyalkanoic acid synthase | - |
| MJO57_RS28690 | - | 6384830..6385006 (-) | 177 | WP_252020649.1 | SDR family oxidoreductase | - |
| MJO57_RS28695 (MJO57_28575) | - | 6385041..6385583 (-) | 543 | WP_252020651.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| MJO57_RS28700 (MJO57_28580) | - | 6386086..6387071 (-) | 986 | Protein_5749 | IS5 family transposase | - |
| MJO57_RS28705 (MJO57_28585) | - | 6387279..6388640 (+) | 1362 | WP_252018151.1 | ISNCY family transposase | - |
| MJO57_RS28710 (MJO57_28590) | - | 6388887..6390401 (-) | 1515 | WP_252017330.1 | IS66 family transposase | - |
| MJO57_RS28715 (MJO57_28595) | - | 6390555..6390812 (+) | 258 | WP_252020653.1 | hypothetical protein | - |
| MJO57_RS28720 (MJO57_28600) | - | 6391069..6392992 (+) | 1924 | Protein_5753 | PrkA family serine protein kinase | - |
| MJO57_RS28725 (MJO57_28605) | - | 6393090..6394379 (+) | 1290 | WP_252020654.1 | YeaH/YhbH family protein | - |
| MJO57_RS28730 (MJO57_28610) | - | 6394366..6395946 (+) | 1581 | WP_252020656.1 | SpoVR family protein | - |
| MJO57_RS28735 (MJO57_28615) | - | 6396155..6396595 (+) | 441 | WP_252020658.1 | regulatory protein RecX | - |
| MJO57_RS28740 (MJO57_28620) | - | 6396929..6397459 (+) | 531 | WP_066017860.1 | hypothetical protein | - |
| MJO57_RS28745 (MJO57_28625) | ltrA | 6397822..6399084 (-) | 1263 | WP_252020660.1 | group II intron reverse transcriptase/maturase | - |
| MJO57_RS28750 (MJO57_28630) | - | 6399760..6400509 (+) | 750 | WP_252020662.1 | hypothetical protein | - |
| MJO57_RS28755 (MJO57_28635) | - | 6401333..6402505 (+) | 1173 | WP_252020664.1 | IS110 family transposase | - |
| MJO57_RS28760 (MJO57_28640) | - | 6402467..6404104 (-) | 1638 | WP_252020666.1 | IS1634 family transposase | - |
| MJO57_RS32945 | - | 6404167..6404289 (+) | 123 | WP_256492691.1 | hypothetical protein | - |
| MJO57_RS28765 (MJO57_28645) | - | 6404326..6404649 (-) | 324 | WP_252020668.1 | hypothetical protein | - |
| MJO57_RS28770 (MJO57_28650) | - | 6404707..6405519 (-) | 813 | WP_252020669.1 | hypothetical protein | - |
| MJO57_RS28775 (MJO57_28655) | - | 6405548..6405691 (-) | 144 | WP_252020671.1 | hypothetical protein | - |
| MJO57_RS28780 (MJO57_28660) | - | 6405948..6407993 (-) | 2046 | WP_252020673.1 | hypothetical protein | - |
| MJO57_RS28785 (MJO57_28665) | - | 6408103..6408585 (-) | 483 | WP_252020675.1 | hypothetical protein | - |
| MJO57_RS28790 (MJO57_28670) | - | 6408619..6409710 (-) | 1092 | WP_252020677.1 | hypothetical protein | - |
| MJO57_RS28795 (MJO57_28675) | - | 6409686..6410108 (-) | 423 | WP_252020679.1 | hypothetical protein | - |
| MJO57_RS28800 (MJO57_28680) | - | 6410048..6410296 (-) | 249 | WP_066017877.1 | hypothetical protein | - |
| MJO57_RS28805 (MJO57_28685) | - | 6410299..6410706 (-) | 408 | WP_252020681.1 | 3TM-type holin | - |
| MJO57_RS28810 (MJO57_28690) | - | 6410699..6411097 (-) | 399 | WP_252020683.1 | M15 family metallopeptidase | - |
| MJO57_RS28815 (MJO57_28695) | - | 6411240..6411560 (-) | 321 | WP_252020685.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MJO57_RS28820 (MJO57_28700) | - | 6411557..6411799 (-) | 243 | WP_252020687.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| MJO57_RS28825 (MJO57_28705) | - | 6411874..6412401 (-) | 528 | WP_252020689.1 | hypothetical protein | - |
| MJO57_RS28830 (MJO57_28710) | - | 6412482..6412655 (-) | 174 | WP_252020691.1 | hypothetical protein | - |
| MJO57_RS28835 (MJO57_28715) | - | 6412676..6412945 (-) | 270 | WP_252020694.1 | Ref family recombination enhancement nuclease | - |
| MJO57_RS28840 (MJO57_28720) | - | 6412956..6413360 (-) | 405 | WP_252020696.1 | hypothetical protein | - |
| MJO57_RS28845 (MJO57_28725) | - | 6413393..6413893 (-) | 501 | WP_252020698.1 | DUF1367 family protein | - |
| MJO57_RS28850 (MJO57_28730) | - | 6413893..6414465 (-) | 573 | WP_252020700.1 | hypothetical protein | - |
| MJO57_RS28855 (MJO57_28735) | - | 6414398..6414940 (-) | 543 | WP_252020702.1 | hypothetical protein | - |
| MJO57_RS28860 (MJO57_28740) | - | 6415014..6416528 (-) | 1515 | WP_252020703.1 | IS66 family transposase | - |
| MJO57_RS28865 (MJO57_28745) | - | 6416525..6417142 (-) | 618 | WP_252020705.1 | hypothetical protein | - |
| MJO57_RS28870 (MJO57_28750) | - | 6417139..6417441 (-) | 303 | WP_252020707.1 | hypothetical protein | - |
| MJO57_RS28875 (MJO57_28755) | - | 6417656..6418297 (+) | 642 | WP_252020709.1 | helix-turn-helix domain-containing protein | - |
| MJO57_RS28880 (MJO57_28760) | - | 6418807..6419139 (+) | 333 | WP_252020711.1 | hypothetical protein | - |
| MJO57_RS28885 (MJO57_28765) | - | 6419132..6419506 (+) | 375 | WP_252020713.1 | hypothetical protein | - |
| MJO57_RS28890 (MJO57_28770) | - | 6419496..6420362 (+) | 867 | WP_252020714.1 | ERF family protein | - |
| MJO57_RS28895 (MJO57_28775) | - | 6420359..6421276 (+) | 918 | WP_252020716.1 | YqaJ viral recombinase family protein | - |
| MJO57_RS28900 (MJO57_28780) | ssb | 6421289..6421801 (+) | 513 | WP_252020718.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 170 a.a. Molecular weight: 19246.29 Da Isoelectric Point: 8.4795
>NTDB_id=657305 MJO57_RS28900 WP_252020718.1 6421289..6421801(+) (ssb) [Endozoicomonas sp. SCSIO W0465]
MSRGVNKVILVGHVGQDPVVRYTPGGEAVANISLATSEKWKDRNGQPQERTEWHRIVTFGKLADIAQQLVRKGSKLYIEG
KLQTRKWQDNHGQDRYTTEVVVTGFNGQIQILDKLNEQPAQQQQQHQPPQHAAHHGNHHQPQNTRYPTKTNPPSSPPAEG
YDDYDDSIPF
MSRGVNKVILVGHVGQDPVVRYTPGGEAVANISLATSEKWKDRNGQPQERTEWHRIVTFGKLADIAQQLVRKGSKLYIEG
KLQTRKWQDNHGQDRYTTEVVVTGFNGQIQILDKLNEQPAQQQQQHQPPQHAAHHGNHHQPQNTRYPTKTNPPSSPPAEG
YDDYDDSIPF
Nucleotide
Download Length: 513 bp
>NTDB_id=657305 MJO57_RS28900 WP_252020718.1 6421289..6421801(+) (ssb) [Endozoicomonas sp. SCSIO W0465]
ATGAGCAGAGGCGTTAATAAAGTCATCCTGGTTGGGCATGTCGGGCAGGACCCCGTCGTGCGCTATACCCCCGGTGGCGA
AGCGGTGGCCAACATCAGTCTTGCTACCTCGGAGAAATGGAAGGACCGGAACGGACAGCCACAGGAAAGAACCGAGTGGC
ACCGCATCGTCACCTTCGGCAAGCTGGCAGACATTGCCCAGCAGCTGGTGCGCAAGGGCAGCAAGCTCTACATCGAAGGC
AAACTCCAGACCCGCAAGTGGCAGGACAATCACGGCCAGGACCGATACACCACGGAAGTCGTGGTCACCGGCTTCAACGG
ACAGATTCAGATCCTGGACAAGCTGAATGAGCAGCCTGCCCAGCAACAACAACAGCATCAGCCACCACAACACGCCGCTC
ACCACGGCAACCATCACCAGCCACAGAACACCCGCTACCCAACCAAGACGAACCCGCCGTCATCGCCACCCGCTGAGGGG
TATGACGACTACGATGACTCGATTCCTTTCTAA
ATGAGCAGAGGCGTTAATAAAGTCATCCTGGTTGGGCATGTCGGGCAGGACCCCGTCGTGCGCTATACCCCCGGTGGCGA
AGCGGTGGCCAACATCAGTCTTGCTACCTCGGAGAAATGGAAGGACCGGAACGGACAGCCACAGGAAAGAACCGAGTGGC
ACCGCATCGTCACCTTCGGCAAGCTGGCAGACATTGCCCAGCAGCTGGTGCGCAAGGGCAGCAAGCTCTACATCGAAGGC
AAACTCCAGACCCGCAAGTGGCAGGACAATCACGGCCAGGACCGATACACCACGGAAGTCGTGGTCACCGGCTTCAACGG
ACAGATTCAGATCCTGGACAAGCTGAATGAGCAGCCTGCCCAGCAACAACAACAGCATCAGCCACCACAACACGCCGCTC
ACCACGGCAACCATCACCAGCCACAGAACACCCGCTACCCAACCAAGACGAACCCGCCGTCATCGCCACCCGCTGAGGGG
TATGACGACTACGATGACTCGATTCCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
51.913 |
100 |
0.559 |
| ssb | Glaesserella parasuis strain SC1401 |
42.857 |
100 |
0.459 |
| ssb | Neisseria meningitidis MC58 |
40.782 |
100 |
0.429 |
| ssb | Neisseria gonorrhoeae MS11 |
40.782 |
100 |
0.429 |