Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | MIS33_RS08540 | Genome accession | NZ_CP092359 |
| Coordinates | 1715552..1715884 (+) | Length | 110 a.a. |
| NCBI ID | WP_249451468.1 | Uniprot ID | - |
| Organism | Wielerella bovis strain 08LB461 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1684742..1748582 | 1715552..1715884 | within | 0 |
Gene organization within MGE regions
Location: 1684742..1748582
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MIS33_RS08360 (MIS33_08360) | - | 1684742..1685185 (-) | 444 | WP_249451442.1 | hypothetical protein | - |
| MIS33_RS08365 (MIS33_08365) | - | 1685182..1685505 (-) | 324 | WP_249447501.1 | hypothetical protein | - |
| MIS33_RS08370 (MIS33_08370) | - | 1685502..1685984 (-) | 483 | WP_249451443.1 | M15 family metallopeptidase | - |
| MIS33_RS08375 (MIS33_08375) | - | 1686021..1686350 (-) | 330 | WP_249451444.1 | hypothetical protein | - |
| MIS33_RS08380 (MIS33_08380) | - | 1686323..1686772 (-) | 450 | WP_249447498.1 | hypothetical protein | - |
| MIS33_RS08385 (MIS33_08385) | - | 1686928..1687230 (-) | 303 | WP_249451445.1 | hypothetical protein | - |
| MIS33_RS08390 (MIS33_08390) | - | 1687288..1692354 (-) | 5067 | WP_249451446.1 | phage tail protein | - |
| MIS33_RS08395 (MIS33_08395) | - | 1692360..1693076 (-) | 717 | WP_249451447.1 | tail assembly protein | - |
| MIS33_RS08400 (MIS33_08400) | - | 1693165..1693443 (+) | 279 | WP_249447494.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MIS33_RS08405 (MIS33_08405) | - | 1693501..1693809 (+) | 309 | WP_249447493.1 | HigA family addiction module antitoxin | - |
| MIS33_RS08410 (MIS33_08410) | - | 1693845..1694600 (-) | 756 | WP_249451448.1 | C40 family peptidase | - |
| MIS33_RS08415 (MIS33_08415) | - | 1694579..1695286 (-) | 708 | WP_249451604.1 | phage minor tail protein L | - |
| MIS33_RS08420 (MIS33_08420) | - | 1695298..1695627 (-) | 330 | WP_249451449.1 | phage tail protein | - |
| MIS33_RS08425 (MIS33_08425) | - | 1695698..1696162 (-) | 465 | WP_249451450.1 | hypothetical protein | - |
| MIS33_RS08430 (MIS33_08430) | - | 1696256..1699582 (-) | 3327 | WP_249451451.1 | phage tail tape measure protein | - |
| MIS33_RS08435 (MIS33_08435) | - | 1699579..1699875 (-) | 297 | WP_249451452.1 | DUF1799 domain-containing protein | - |
| MIS33_RS08440 (MIS33_08440) | - | 1699893..1700207 (-) | 315 | WP_249447488.1 | phage tail assembly chaperone | - |
| MIS33_RS08445 (MIS33_08445) | - | 1700257..1700895 (-) | 639 | WP_249451453.1 | phage tail protein | - |
| MIS33_RS08450 (MIS33_08450) | - | 1700961..1701122 (-) | 162 | WP_249447486.1 | hypothetical protein | - |
| MIS33_RS08455 (MIS33_08455) | - | 1701119..1701469 (-) | 351 | WP_249451454.1 | DUF3168 domain-containing protein | - |
| MIS33_RS08460 (MIS33_08460) | - | 1701462..1701932 (-) | 471 | WP_249451455.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| MIS33_RS08465 (MIS33_08465) | - | 1701929..1702174 (-) | 246 | WP_249451456.1 | hypothetical protein | - |
| MIS33_RS08470 (MIS33_08470) | - | 1702181..1702498 (-) | 318 | WP_249451457.1 | phage head closure protein | - |
| MIS33_RS08475 (MIS33_08475) | - | 1702508..1703212 (-) | 705 | WP_249451458.1 | 3'-5' exonuclease | - |
| MIS33_RS08480 (MIS33_08480) | - | 1703295..1703591 (-) | 297 | WP_249451459.1 | head-tail connector protein | - |
| MIS33_RS08485 (MIS33_08485) | - | 1703591..1703902 (-) | 312 | WP_249451460.1 | hypothetical protein | - |
| MIS33_RS08490 (MIS33_08490) | - | 1703996..1705228 (-) | 1233 | WP_249451461.1 | phage major capsid protein | - |
| MIS33_RS08495 (MIS33_08495) | - | 1705230..1706060 (-) | 831 | WP_249451462.1 | head maturation protease, ClpP-related | - |
| MIS33_RS08500 (MIS33_08500) | - | 1706057..1707289 (-) | 1233 | WP_249451463.1 | phage portal protein | - |
| MIS33_RS08505 (MIS33_08505) | - | 1707346..1709040 (-) | 1695 | WP_249451464.1 | terminase large subunit | - |
| MIS33_RS08510 (MIS33_08510) | - | 1709042..1709629 (-) | 588 | WP_249447474.1 | hypothetical protein | - |
| MIS33_RS11725 | - | 1709791..1710102 (-) | 312 | WP_283397656.1 | HNH endonuclease signature motif containing protein | - |
| MIS33_RS08520 (MIS33_08520) | - | 1710236..1710628 (-) | 393 | WP_249451465.1 | hypothetical protein | - |
| MIS33_RS08525 (MIS33_08525) | - | 1711152..1714040 (-) | 2889 | WP_249451466.1 | DUF5906 domain-containing protein | - |
| MIS33_RS08530 (MIS33_08530) | - | 1714203..1714397 (-) | 195 | WP_249447471.1 | Cro/CI family transcriptional regulator | - |
| MIS33_RS08535 (MIS33_08535) | - | 1714519..1715091 (+) | 573 | WP_249451467.1 | helix-turn-helix domain-containing protein | - |
| MIS33_RS08540 (MIS33_08540) | ssb | 1715552..1715884 (+) | 333 | WP_249451468.1 | single-stranded DNA-binding protein | Machinery gene |
| MIS33_RS08545 (MIS33_08545) | - | 1715887..1716207 (+) | 321 | WP_249451469.1 | hypothetical protein | - |
| MIS33_RS08550 (MIS33_08550) | - | 1716217..1716435 (+) | 219 | WP_249451470.1 | hypothetical protein | - |
| MIS33_RS08555 (MIS33_08555) | - | 1716507..1717223 (+) | 717 | WP_249451471.1 | hypothetical protein | - |
| MIS33_RS08560 (MIS33_08560) | - | 1717186..1717440 (+) | 255 | WP_249451472.1 | flagellar protein required for flagellar formation | - |
| MIS33_RS08565 (MIS33_08565) | - | 1717467..1718348 (+) | 882 | WP_249451473.1 | hypothetical protein | - |
| MIS33_RS08570 (MIS33_08570) | - | 1718360..1718557 (+) | 198 | WP_249451474.1 | hypothetical protein | - |
| MIS33_RS08575 (MIS33_08575) | - | 1718597..1719805 (-) | 1209 | WP_249451475.1 | integrase arm-type DNA-binding domain-containing protein | - |
| MIS33_RS08585 (MIS33_08585) | - | 1720159..1720644 (-) | 486 | WP_249442133.1 | GNAT family N-acetyltransferase | - |
| MIS33_RS08590 (MIS33_08590) | - | 1720842..1721633 (+) | 792 | WP_249442134.1 | basic amino acid ABC transporter substrate-binding protein | - |
| MIS33_RS08595 (MIS33_08595) | - | 1721733..1722323 (+) | 591 | WP_249447459.1 | hypothetical protein | - |
| MIS33_RS08600 (MIS33_08600) | alaS | 1722598..1725489 (+) | 2892 | WP_249447458.1 | alanine--tRNA ligase | - |
| MIS33_RS08605 (MIS33_08605) | - | 1725578..1727563 (+) | 1986 | WP_249447457.1 | N-6 DNA methylase | - |
| MIS33_RS08610 (MIS33_08610) | - | 1727611..1728990 (+) | 1380 | WP_249451476.1 | restriction endonuclease subunit S | - |
| MIS33_RS08615 (MIS33_08615) | - | 1729032..1729748 (+) | 717 | WP_249447455.1 | restriction endonuclease subunit S | - |
| MIS33_RS08620 (MIS33_08620) | - | 1729745..1730572 (-) | 828 | WP_249447454.1 | DUF72 domain-containing protein | - |
| MIS33_RS08625 (MIS33_08625) | - | 1730820..1731353 (+) | 534 | WP_249447453.1 | NUDIX hydrolase | - |
| MIS33_RS08630 (MIS33_08630) | gloB | 1731350..1732114 (+) | 765 | WP_249447452.1 | hydroxyacylglutathione hydrolase | - |
| MIS33_RS08640 (MIS33_08640) | - | 1732365..1732757 (-) | 393 | WP_249447695.1 | diacylglycerol kinase | - |
| MIS33_RS08645 (MIS33_08645) | gmhB | 1732919..1733488 (+) | 570 | WP_249447451.1 | D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase | - |
| MIS33_RS08650 (MIS33_08650) | - | 1733485..1734450 (+) | 966 | WP_249447450.1 | glycosyltransferase family 2 protein | - |
| MIS33_RS08655 (MIS33_08655) | menA | 1734335..1735414 (+) | 1080 | WP_249447449.1 | 1,4-dihydroxy-2-naphthoate octaprenyltransferase | - |
| MIS33_RS08660 (MIS33_08660) | - | 1735565..1736032 (+) | 468 | WP_249447448.1 | DUF4149 domain-containing protein | - |
| MIS33_RS08665 (MIS33_08665) | - | 1736293..1736772 (+) | 480 | WP_249447447.1 | hypothetical protein | - |
| MIS33_RS08670 (MIS33_08670) | - | 1736776..1737565 (+) | 790 | Protein_1681 | glycosyltransferase | - |
| MIS33_RS08675 (MIS33_08675) | - | 1737642..1738874 (+) | 1233 | WP_249451477.1 | exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase | - |
| MIS33_RS08680 (MIS33_08680) | yaaA | 1739042..1739815 (+) | 774 | WP_249451478.1 | peroxide stress protein YaaA | - |
| MIS33_RS08685 (MIS33_08685) | kdsA | 1739997..1740842 (-) | 846 | WP_249447442.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| MIS33_RS08690 (MIS33_08690) | - | 1740978..1741946 (-) | 969 | WP_283397673.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| MIS33_RS08695 (MIS33_08695) | - | 1742235..1742774 (+) | 540 | WP_249447694.1 | HAD-IIIA family hydrolase | - |
| MIS33_RS08700 (MIS33_08700) | lptC | 1742771..1743349 (+) | 579 | WP_249447440.1 | LPS export ABC transporter periplasmic protein LptC | - |
| MIS33_RS08705 (MIS33_08705) | lptA | 1743327..1743848 (+) | 522 | WP_249442155.1 | lipopolysaccharide transport periplasmic protein LptA | - |
| MIS33_RS08710 (MIS33_08710) | - | 1743861..1744499 (+) | 639 | WP_249447439.1 | FMN-binding negative transcriptional regulator | - |
| MIS33_RS08715 (MIS33_08715) | lptB | 1744552..1745280 (+) | 729 | WP_249442157.1 | LPS export ABC transporter ATP-binding protein | - |
| MIS33_RS08720 (MIS33_08720) | rpoN | 1745345..1746703 (+) | 1359 | WP_249447438.1 | RNA polymerase factor sigma-54 | - |
| MIS33_RS08725 (MIS33_08725) | raiA | 1746762..1747046 (+) | 285 | WP_249442159.1 | ribosome-associated translation inhibitor RaiA | - |
| MIS33_RS08730 (MIS33_08730) | - | 1747015..1747188 (-) | 174 | WP_249447437.1 | hypothetical protein | - |
| MIS33_RS08735 (MIS33_08735) | rsmG | 1747180..1747821 (+) | 642 | WP_249442160.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| MIS33_RS08740 (MIS33_08740) | - | 1747818..1748582 (+) | 765 | WP_249445572.1 | AAA family ATPase | - |
Sequence
Protein
Download Length: 110 a.a. Molecular weight: 12757.62 Da Isoelectric Point: 7.3831
>NTDB_id=656727 MIS33_RS08540 WP_249451468.1 1715552..1715884(+) (ssb) [Wielerella bovis strain 08LB461]
MHNLVILIGNLGKDPEIRHMPDGDPVASFSLATSETWIDKQGQKRETTQWHNIVCYRGTAKIAQDWLKKGKLICIEGKIV
YRQWQDEHQVTHYKTEIIAEQIQMLGKKDD
MHNLVILIGNLGKDPEIRHMPDGDPVASFSLATSETWIDKQGQKRETTQWHNIVCYRGTAKIAQDWLKKGKLICIEGKIV
YRQWQDEHQVTHYKTEIIAEQIQMLGKKDD
Nucleotide
Download Length: 333 bp
>NTDB_id=656727 MIS33_RS08540 WP_249451468.1 1715552..1715884(+) (ssb) [Wielerella bovis strain 08LB461]
ATGCACAATCTCGTTATTTTAATCGGCAATTTGGGCAAAGACCCCGAAATCCGCCATATGCCCGATGGCGACCCCGTTGC
CAGTTTTTCTCTTGCCACATCCGAAACTTGGATAGACAAGCAAGGGCAGAAACGCGAAACAACCCAATGGCACAACATCG
TTTGCTATCGTGGCACAGCCAAAATCGCACAAGATTGGCTCAAAAAAGGCAAACTCATTTGCATTGAAGGAAAAATTGTT
TACCGCCAATGGCAAGATGAGCATCAAGTAACTCACTACAAAACAGAAATTATTGCCGAACAAATTCAAATGCTTGGCAA
AAAGGATGATTAA
ATGCACAATCTCGTTATTTTAATCGGCAATTTGGGCAAAGACCCCGAAATCCGCCATATGCCCGATGGCGACCCCGTTGC
CAGTTTTTCTCTTGCCACATCCGAAACTTGGATAGACAAGCAAGGGCAGAAACGCGAAACAACCCAATGGCACAACATCG
TTTGCTATCGTGGCACAGCCAAAATCGCACAAGATTGGCTCAAAAAAGGCAAACTCATTTGCATTGAAGGAAAAATTGTT
TACCGCCAATGGCAAGATGAGCATCAAGTAACTCACTACAAAACAGAAATTATTGCCGAACAAATTCAAATGCTTGGCAA
AAAGGATGATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Neisseria meningitidis MC58 |
49.074 |
98.182 |
0.482 |
| ssb | Neisseria gonorrhoeae MS11 |
49.074 |
98.182 |
0.482 |
| ssb | Glaesserella parasuis strain SC1401 |
50 |
94.545 |
0.473 |
| ssb | Vibrio cholerae strain A1552 |
45.946 |
100 |
0.464 |