Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   L4F93_RS08560 Genome accession   NZ_CP091456
Coordinates   1795408..1795917 (+) Length   169 a.a.
NCBI ID   WP_250349891.1    Uniprot ID   -
Organism   Avibacterium sp. 20-132     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1745412..1795917 1795408..1795917 within 0


Gene organization within MGE regions


Location: 1745412..1795917
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L4F93_RS08260 (L4F93_08260) - 1745412..1746503 (-) 1092 WP_250349839.1 site-specific integrase -
  L4F93_RS08265 (L4F93_08265) - 1746733..1747215 (-) 483 WP_250349840.1 class I SAM-dependent methyltransferase -
  L4F93_RS08270 (L4F93_08270) - 1747274..1747756 (-) 483 WP_250349841.1 hypothetical protein -
  L4F93_RS08275 (L4F93_08275) - 1747743..1747901 (-) 159 WP_250349842.1 hypothetical protein -
  L4F93_RS08280 (L4F93_08280) - 1747904..1748122 (-) 219 WP_250349843.1 hypothetical protein -
  L4F93_RS08285 (L4F93_08285) - 1748119..1748412 (-) 294 WP_250349844.1 DUF6378 domain-containing protein -
  L4F93_RS08290 (L4F93_08290) - 1748402..1749802 (-) 1401 WP_250349845.1 DEAD/DEAH box helicase -
  L4F93_RS08295 (L4F93_08295) - 1749790..1750068 (-) 279 WP_250351667.1 VRR-NUC domain-containing protein -
  L4F93_RS08300 (L4F93_08300) - 1750068..1750274 (-) 207 WP_250349846.1 hypothetical protein -
  L4F93_RS08305 (L4F93_08305) - 1750277..1752340 (-) 2064 WP_250349847.1 DNA polymerase -
  L4F93_RS08310 (L4F93_08310) - 1752315..1752500 (-) 186 WP_250349848.1 hypothetical protein -
  L4F93_RS08315 (L4F93_08315) - 1752589..1753395 (-) 807 WP_250349849.1 DUF2303 family protein -
  L4F93_RS08320 (L4F93_08320) - 1753456..1753800 (-) 345 WP_250349850.1 hypothetical protein -
  L4F93_RS08325 (L4F93_08325) - 1753883..1754431 (-) 549 WP_250349851.1 DUF2815 family protein -
  L4F93_RS08330 (L4F93_08330) - 1754452..1755663 (-) 1212 WP_250349852.1 DUF2800 domain-containing protein -
  L4F93_RS08335 (L4F93_08335) - 1755653..1756045 (-) 393 WP_250349853.1 hypothetical protein -
  L4F93_RS08340 (L4F93_08340) - 1756188..1756478 (-) 291 WP_250349854.1 hypothetical protein -
  L4F93_RS08350 (L4F93_08350) - 1756902..1757582 (-) 681 WP_250349855.1 XRE family transcriptional regulator -
  L4F93_RS08355 (L4F93_08355) - 1757701..1757907 (+) 207 WP_250349856.1 helix-turn-helix domain-containing protein -
  L4F93_RS08360 (L4F93_08360) - 1757916..1760354 (+) 2439 WP_250349857.1 DUF5906 domain-containing protein -
  L4F93_RS08365 (L4F93_08365) - 1760699..1761043 (+) 345 WP_100295766.1 antiterminator Q family protein -
  L4F93_RS08370 (L4F93_08370) - 1761193..1761438 (+) 246 WP_207761604.1 hypothetical protein -
  L4F93_RS08375 (L4F93_08375) - 1761435..1761956 (+) 522 WP_250349858.1 lysozyme -
  L4F93_RS08380 (L4F93_08380) - 1761929..1762270 (+) 342 WP_250349859.1 DUF2570 family protein -
  L4F93_RS08385 (L4F93_08385) - 1762445..1762768 (+) 324 WP_065231301.1 HNH endonuclease signature motif containing protein -
  L4F93_RS08390 (L4F93_08390) - 1762867..1763328 (+) 462 WP_100295770.1 terminase -
  L4F93_RS08395 (L4F93_08395) - 1763328..1764839 (+) 1512 WP_250349860.1 terminase TerL endonuclease subunit -
  L4F93_RS08400 (L4F93_08400) - 1764836..1766080 (+) 1245 WP_250349861.1 phage portal protein -
  L4F93_RS08405 (L4F93_08405) - 1766064..1766723 (+) 660 WP_250349862.1 HK97 family phage prohead protease -
  L4F93_RS08410 (L4F93_08410) - 1766725..1767924 (+) 1200 WP_250349863.1 phage major capsid protein -
  L4F93_RS08415 (L4F93_08415) - 1767977..1768291 (+) 315 WP_250349864.1 head-tail connector protein -
  L4F93_RS08420 (L4F93_08420) - 1768292..1768615 (+) 324 WP_250349865.1 phage head closure protein -
  L4F93_RS08425 (L4F93_08425) - 1768608..1769087 (+) 480 WP_250349866.1 HK97-gp10 family putative phage morphogenesis protein -
  L4F93_RS08430 (L4F93_08430) - 1769084..1769428 (+) 345 WP_250349867.1 DUF3168 domain-containing protein -
  L4F93_RS08435 (L4F93_08435) - 1769431..1770084 (+) 654 WP_250349868.1 hypothetical protein -
  L4F93_RS08440 (L4F93_08440) - 1770147..1770560 (+) 414 WP_250349869.1 hypothetical protein -
  L4F93_RS08445 (L4F93_08445) - 1770605..1770841 (+) 237 WP_250349870.1 DUF4035 domain-containing protein -
  L4F93_RS08450 (L4F93_08450) - 1770931..1771440 (+) 510 WP_250349871.1 hypothetical protein -
  L4F93_RS08455 (L4F93_08455) - 1771774..1772679 (+) 906 WP_250349872.1 phage antirepressor N-terminal domain-containing protein -
  L4F93_RS08460 (L4F93_08460) - 1772736..1773053 (+) 318 WP_250349873.1 DUF2513 domain-containing protein -
  L4F93_RS08465 (L4F93_08465) - 1773107..1773313 (+) 207 WP_103853811.1 hypothetical protein -
  L4F93_RS08470 (L4F93_08470) - 1773376..1776873 (+) 3498 WP_250349874.1 tape measure protein -
  L4F93_RS08475 (L4F93_08475) - 1776873..1777199 (+) 327 WP_250349875.1 phage tail protein -
  L4F93_RS08480 (L4F93_08480) - 1777199..1777921 (+) 723 WP_250349876.1 phage minor tail protein L -
  L4F93_RS08485 (L4F93_08485) - 1777918..1778661 (+) 744 WP_250349877.1 C40 family peptidase -
  L4F93_RS08490 (L4F93_08490) - 1778604..1779212 (+) 609 WP_250349878.1 tail assembly protein -
  L4F93_RS08495 (L4F93_08495) - 1779242..1784614 (+) 5373 WP_250349879.1 phage tail protein -
  L4F93_RS08500 (L4F93_08500) - 1784676..1785002 (+) 327 WP_250349880.1 hypothetical protein -
  L4F93_RS08505 (L4F93_08505) - 1785005..1785331 (+) 327 WP_250349881.1 hypothetical protein -
  L4F93_RS08510 (L4F93_08510) - 1785343..1786416 (+) 1074 WP_250349882.1 collagen-like protein -
  L4F93_RS08515 (L4F93_08515) - 1786465..1786695 (+) 231 WP_250349883.1 DUF1353 domain-containing protein -
  L4F93_RS08520 (L4F93_08520) - 1787019..1787861 (+) 843 WP_250349884.1 ParA family protein -
  L4F93_RS08525 (L4F93_08525) dnaB 1787854..1789230 (+) 1377 WP_250349885.1 replicative DNA helicase -
  L4F93_RS08530 (L4F93_08530) - 1789220..1790926 (+) 1707 WP_250349886.1 ParB family protein -
  L4F93_RS08535 (L4F93_08535) - 1790937..1791488 (+) 552 WP_250349887.1 DUF2857 domain-containing protein -
  L4F93_RS08540 (L4F93_08540) - 1791652..1792878 (+) 1227 WP_250349888.1 STY4528 family pathogenicity island replication protein -
  L4F93_RS08545 (L4F93_08545) - 1793379..1794131 (+) 753 WP_250349889.1 TIGR03761 family integrating conjugative element protein -
  L4F93_RS08550 (L4F93_08550) - 1794166..1794687 (+) 522 WP_250349890.1 DUF3158 family protein -
  L4F93_RS08555 (L4F93_08555) - 1794866..1795207 (+) 342 WP_035689393.1 hypothetical protein -
  L4F93_RS08560 (L4F93_08560) ssb 1795408..1795917 (+) 510 WP_250349891.1 single-stranded DNA-binding protein Machinery gene

Sequence

Protein


Download         Length: 169 a.a.        Molecular weight: 19142.21 Da        Isoelectric Point: 5.8037

>NTDB_id=651447 L4F93_RS08560 WP_250349891.1 1795408..1795917(+) (ssb) [Avibacterium sp. 20-132]
MAGINKVIIVGNLGADPEVRTMPNGEAVSNISVATSESWIDKNTSEKRELTEWHRIVFYRRQAEIVGEYLRKGSKVYVEG
RLRTRKWQDQNGQDRYTTEIQGDVLQMLDSRPERYQAGQATQVGAAQQGRNQYAQPTQPVHQAPRNTPQSTQAPQSDIND
MPLDDDIPF

Nucleotide


Download         Length: 510 bp        

>NTDB_id=651447 L4F93_RS08560 WP_250349891.1 1795408..1795917(+) (ssb) [Avibacterium sp. 20-132]
ATGGCAGGGATTAATAAAGTGATTATCGTGGGTAACCTTGGTGCAGATCCTGAAGTAAGAACAATGCCGAATGGCGAAGC
GGTTTCCAATATAAGTGTGGCAACTAGTGAAAGTTGGATAGATAAGAATACAAGTGAAAAACGTGAATTAACCGAGTGGC
ATCGGATTGTGTTTTATCGTCGTCAAGCTGAGATTGTGGGAGAATATTTACGCAAAGGCTCGAAAGTTTATGTCGAGGGG
CGATTAAGAACCCGTAAATGGCAAGACCAAAATGGGCAAGATCGATACACCACAGAAATCCAAGGAGATGTACTTCAAAT
GTTAGATAGCCGTCCTGAGCGCTATCAAGCAGGGCAGGCAACGCAAGTTGGAGCGGCACAACAAGGTCGTAATCAATATG
CGCAACCTACACAGCCTGTGCATCAAGCTCCAAGAAACACTCCACAATCAACGCAAGCACCACAGTCAGATATTAATGAC
ATGCCTTTAGACGATGATATTCCGTTTTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.222

100

0.663
  ssb Vibrio cholerae strain A1552

54.237

100

0.568
  ssb Neisseria meningitidis MC58

46.629

100

0.491
  ssb Neisseria gonorrhoeae MS11

46.629

100

0.491