Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | L2Z48_RS03430 | Genome accession | NZ_CP091371 |
| Coordinates | 719659..719760 (+) | Length | 33 a.a. |
| NCBI ID | WP_168713084.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain AB36-VUB | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 654710..720496 | 719659..719760 | within | 0 |
Gene organization within MGE regions
Location: 654710..720496
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L2Z48_RS03110 (L2Z48_03110) | - | 655111..655671 (-) | 561 | WP_001048150.1 | hypothetical protein | - |
| L2Z48_RS03115 (L2Z48_03115) | - | 655762..656622 (-) | 861 | WP_000838098.1 | pirin family protein | - |
| L2Z48_RS03120 (L2Z48_03120) | hemJ | 656793..657245 (-) | 453 | WP_000339889.1 | protoporphyrinogen oxidase HemJ | - |
| L2Z48_RS03125 (L2Z48_03125) | - | 657264..658493 (-) | 1230 | WP_000832710.1 | beta-ketoacyl-ACP synthase II | - |
| L2Z48_RS03130 (L2Z48_03130) | - | 658790..660115 (+) | 1326 | WP_215743469.1 | EcsC family protein | - |
| L2Z48_RS03135 (L2Z48_03135) | rpsL | 660316..660690 (+) | 375 | WP_000246374.1 | 30S ribosomal protein S12 | - |
| L2Z48_RS03140 (L2Z48_03140) | rpsG | 660850..661320 (+) | 471 | WP_001138055.1 | 30S ribosomal protein S7 | - |
| L2Z48_RS03145 (L2Z48_03145) | fusA | 661499..663637 (+) | 2139 | WP_000113824.1 | elongation factor G | - |
| L2Z48_RS03150 (L2Z48_03150) | tuf | 663732..664922 (+) | 1191 | WP_001029610.1 | elongation factor Tu | - |
| L2Z48_RS03155 (L2Z48_03155) | - | 665126..666007 (+) | 882 | WP_000992305.1 | metal-dependent hydrolase | - |
| L2Z48_RS03160 (L2Z48_03160) | - | 666244..667119 (+) | 876 | WP_000992291.1 | metal-dependent hydrolase | - |
| L2Z48_RS03165 (L2Z48_03165) | rimI | 667228..667683 (+) | 456 | WP_000621543.1 | ribosomal protein S18-alanine N-acetyltransferase | - |
| L2Z48_RS03170 (L2Z48_03170) | - | 667728..668543 (-) | 816 | WP_000844343.1 | arginyltransferase | - |
| L2Z48_RS03175 (L2Z48_03175) | aat | 668562..669293 (-) | 732 | WP_000854785.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| L2Z48_RS03180 (L2Z48_03180) | trxB | 669413..670360 (-) | 948 | WP_001276144.1 | thioredoxin-disulfide reductase | - |
| L2Z48_RS03185 (L2Z48_03185) | - | 670630..673662 (+) | 3033 | WP_000127823.1 | DNA translocase FtsK | - |
| L2Z48_RS03190 (L2Z48_03190) | rhtC | 673812..674432 (+) | 621 | WP_000959259.1 | threonine export protein RhtC | - |
| L2Z48_RS03195 (L2Z48_03195) | - | 674488..675018 (-) | 531 | WP_031969348.1 | tyrosyl-tRNA synthetase | - |
| L2Z48_RS03200 (L2Z48_03200) | - | 675270..675557 (-) | 288 | WP_001218560.1 | PA4642 family protein | - |
| L2Z48_RS03205 (L2Z48_03205) | minE | 675641..675913 (-) | 273 | WP_000896934.1 | cell division topological specificity factor MinE | - |
| L2Z48_RS03210 (L2Z48_03210) | minD | 675916..676728 (-) | 813 | WP_001074362.1 | septum site-determining protein MinD | - |
| L2Z48_RS03215 (L2Z48_03215) | minC | 676799..677521 (-) | 723 | WP_000763677.1 | septum site-determining protein MinC | - |
| L2Z48_RS03220 (L2Z48_03220) | - | 677643..678689 (-) | 1047 | WP_001181639.1 | hypothetical protein | - |
| L2Z48_RS03225 (L2Z48_03225) | - | 678706..679632 (-) | 927 | WP_000100965.1 | acyltransferase | - |
| L2Z48_RS03230 (L2Z48_03230) | - | 679877..680530 (+) | 654 | WP_001202415.1 | OmpA family protein | - |
| L2Z48_RS03235 (L2Z48_03235) | rep | 680724..682763 (+) | 2040 | WP_000093035.1 | DNA helicase Rep | - |
| L2Z48_RS03240 (L2Z48_03240) | dut | 682788..683240 (+) | 453 | WP_000868152.1 | dUTP diphosphatase | - |
| L2Z48_RS03245 (L2Z48_03245) | - | 683439..684857 (+) | 1419 | WP_001102848.1 | phosphomannomutase/phosphoglucomutase | - |
| L2Z48_RS03250 (L2Z48_03250) | argB | 684872..685780 (+) | 909 | WP_001135419.1 | acetylglutamate kinase | - |
| L2Z48_RS03255 (L2Z48_03255) | - | 685901..686683 (+) | 783 | WP_000890282.1 | GNAT family N-acetyltransferase | - |
| L2Z48_RS03260 (L2Z48_03260) | - | 686792..687640 (+) | 849 | WP_215743468.1 | class II glutamine amidotransferase | - |
| L2Z48_RS03265 (L2Z48_03265) | - | 687893..688348 (+) | 456 | WP_000782976.1 | bacteriohemerythrin | - |
| L2Z48_RS03270 (L2Z48_03270) | - | 688501..689568 (+) | 1068 | WP_004748097.1 | hypothetical protein | - |
| L2Z48_RS03275 (L2Z48_03275) | - | 689568..689891 (+) | 324 | WP_000442590.1 | RnfH family protein | - |
| L2Z48_RS03280 (L2Z48_03280) | bamE | 689946..690344 (-) | 399 | WP_001170994.1 | outer membrane protein assembly factor BamE | - |
| L2Z48_RS03285 (L2Z48_03285) | fur | 690456..690893 (+) | 438 | WP_001122847.1 | ferric iron uptake transcriptional regulator | - |
| L2Z48_RS03290 (L2Z48_03290) | pilU | 690963..692081 (-) | 1119 | WP_000347040.1 | PilT/PilU family type 4a pilus ATPase | Machinery gene |
| L2Z48_RS03295 (L2Z48_03295) | pilT | 692109..693146 (-) | 1038 | WP_000355489.1 | type IV pilus twitching motility protein PilT | Machinery gene |
| L2Z48_RS03300 (L2Z48_03300) | - | 693273..693965 (+) | 693 | WP_004748094.1 | YggS family pyridoxal phosphate-dependent enzyme | - |
| L2Z48_RS03305 (L2Z48_03305) | - | 694167..697763 (-) | 3597 | WP_004748092.1 | AAA family ATPase | - |
| L2Z48_RS03310 (L2Z48_03310) | - | 697773..699041 (-) | 1269 | WP_004748090.1 | exonuclease SbcCD subunit D | - |
| L2Z48_RS03315 (L2Z48_03315) | - | 699206..699679 (+) | 474 | WP_215743467.1 | OsmC family protein | - |
| L2Z48_RS03320 (L2Z48_03320) | - | 699747..700124 (-) | 378 | WP_001059437.1 | VOC family protein | - |
| L2Z48_RS03325 (L2Z48_03325) | - | 700504..700956 (+) | 453 | WP_000164151.1 | ABZJ_00895 family protein | - |
| L2Z48_RS03330 (L2Z48_03330) | - | 701044..701949 (+) | 906 | WP_046693190.1 | TIGR01777 family oxidoreductase | - |
| L2Z48_RS03335 (L2Z48_03335) | - | 701941..703056 (-) | 1116 | WP_004748085.1 | FAD-dependent oxidoreductase | - |
| L2Z48_RS03340 (L2Z48_03340) | hemB | 703082..704095 (-) | 1014 | WP_004748084.1 | porphobilinogen synthase | - |
| L2Z48_RS03345 (L2Z48_03345) | - | 704238..704735 (+) | 498 | WP_002156418.1 | thioesterase family protein | - |
| L2Z48_RS03350 (L2Z48_03350) | - | 705005..706156 (+) | 1152 | WP_004748081.1 | EmrA/EmrK family multidrug efflux transporter periplasmic adaptor subunit | - |
| L2Z48_RS03355 (L2Z48_03355) | - | 706163..707686 (+) | 1524 | WP_004748079.1 | DHA2 family efflux MFS transporter permease subunit | - |
| L2Z48_RS03360 (L2Z48_03360) | ggt | 707990..709975 (+) | 1986 | WP_004748076.1 | gamma-glutamyltransferase | - |
| L2Z48_RS03370 (L2Z48_03370) | - | 710677..711906 (+) | 1230 | WP_031999186.1 | tyrosine-type recombinase/integrase | - |
| L2Z48_RS03375 (L2Z48_03375) | - | 712054..712821 (+) | 768 | WP_000578618.1 | hypothetical protein | - |
| L2Z48_RS03380 (L2Z48_03380) | - | 713031..713246 (+) | 216 | WP_000153154.1 | hypothetical protein | - |
| L2Z48_RS03385 (L2Z48_03385) | - | 713249..713458 (+) | 210 | WP_001016479.1 | helix-turn-helix domain-containing protein | - |
| L2Z48_RS03390 (L2Z48_03390) | - | 713455..714009 (+) | 555 | WP_001988245.1 | BRO family protein | - |
| L2Z48_RS03395 (L2Z48_03395) | - | 714002..714370 (+) | 369 | WP_001046481.1 | hypothetical protein | - |
| L2Z48_RS03400 (L2Z48_03400) | - | 714380..714685 (+) | 306 | WP_000787149.1 | hypothetical protein | - |
| L2Z48_RS03405 (L2Z48_03405) | - | 714807..715085 (+) | 279 | WP_001064707.1 | hypothetical protein | - |
| L2Z48_RS03410 (L2Z48_03410) | - | 715098..717563 (+) | 2466 | WP_001022397.1 | DUF927 domain-containing protein | - |
| L2Z48_RS03415 (L2Z48_03415) | - | 717897..718013 (+) | 117 | WP_001992235.1 | single-stranded DNA-binding protein | - |
| L2Z48_RS03425 (L2Z48_03425) | - | 718236..719677 (+) | 1442 | Protein_655 | hypothetical protein | - |
| L2Z48_RS03430 (L2Z48_03430) | ssb | 719659..719760 (+) | 102 | WP_168713084.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 33 a.a. Molecular weight: 3621.22 Da Isoelectric Point: 9.7265
>NTDB_id=650726 L2Z48_RS03430 WP_168713084.1 719659..719760(+) (ssb) [Acinetobacter baumannii strain AB36-VUB]
MVSSQLAEISSKYLKKGGKVYVEGSLCTGKWKD
MVSSQLAEISSKYLKKGGKVYVEGSLCTGKWKD
Nucleotide
Download Length: 102 bp
>NTDB_id=650726 L2Z48_RS03430 WP_168713084.1 719659..719760(+) (ssb) [Acinetobacter baumannii strain AB36-VUB]
TTGGTTAGTTCCCAATTAGCCGAGATTTCCAGTAAGTACCTTAAGAAAGGTGGCAAGGTTTATGTTGAGGGTTCATTGTG
TACTGGGAAGTGGAAAGACTAA
TTGGTTAGTTCCCAATTAGCCGAGATTTCCAGTAAGTACCTTAAGAAAGGTGGCAAGGTTTATGTTGAGGGTTCATTGTG
TACTGGGAAGTGGAAAGACTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.963 |
81.818 |
0.515 |
| ssb | Vibrio cholerae strain A1552 |
55.172 |
87.879 |
0.485 |
| ssb | Neisseria gonorrhoeae MS11 |
53.571 |
84.848 |
0.455 |
| ssb | Neisseria meningitidis MC58 |
53.571 |
84.848 |
0.455 |