Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | L2Z36_RS02635 | Genome accession | NZ_CP091340 |
| Coordinates | 531841..532194 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB227-VUB | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 529475..560811 | 531841..532194 | within | 0 |
Gene organization within MGE regions
Location: 529475..560811
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L2Z36_RS02615 (L2Z36_02615) | - | 529475..530542 (+) | 1068 | WP_000107854.1 | site-specific integrase | - |
| L2Z36_RS02620 (L2Z36_02620) | - | 530570..530866 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| L2Z36_RS02625 (L2Z36_02625) | - | 530863..531084 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| L2Z36_RS02630 (L2Z36_02630) | - | 531094..531831 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| L2Z36_RS02635 (L2Z36_02635) | ssb | 531841..532194 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| L2Z36_RS02640 (L2Z36_02640) | - | 532182..532499 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| L2Z36_RS02645 (L2Z36_02645) | - | 532492..532662 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| L2Z36_RS02650 (L2Z36_02650) | - | 532652..533203 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| L2Z36_RS02655 (L2Z36_02655) | - | 533269..533601 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| L2Z36_RS02660 (L2Z36_02660) | - | 533598..536336 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| L2Z36_RS02665 (L2Z36_02665) | - | 536430..536621 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| L2Z36_RS02670 (L2Z36_02670) | - | 536714..537055 (+) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| L2Z36_RS02675 (L2Z36_02675) | - | 537100..537315 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| L2Z36_RS02680 (L2Z36_02680) | - | 537440..538255 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| L2Z36_RS02685 (L2Z36_02685) | - | 538363..538557 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| L2Z36_RS02690 (L2Z36_02690) | - | 538867..539745 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| L2Z36_RS02695 (L2Z36_02695) | - | 539745..540026 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| L2Z36_RS02700 (L2Z36_02700) | - | 540342..540542 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| L2Z36_RS02705 (L2Z36_02705) | - | 540539..540778 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| L2Z36_RS02710 (L2Z36_02710) | - | 540908..542221 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| L2Z36_RS02715 (L2Z36_02715) | - | 542222..542662 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| L2Z36_RS02720 (L2Z36_02720) | - | 542668..545118 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| L2Z36_RS18490 | - | 545132..545245 (-) | 114 | WP_002013839.1 | GpE family phage tail protein | - |
| L2Z36_RS02725 (L2Z36_02725) | - | 545272..545613 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| L2Z36_RS02730 (L2Z36_02730) | - | 545680..546198 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| L2Z36_RS02735 (L2Z36_02735) | - | 546211..547386 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| L2Z36_RS02740 (L2Z36_02740) | - | 547536..549488 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| L2Z36_RS02745 (L2Z36_02745) | - | 549500..550105 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| L2Z36_RS02750 (L2Z36_02750) | - | 550105..551007 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| L2Z36_RS02755 (L2Z36_02755) | - | 551004..551351 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| L2Z36_RS02760 (L2Z36_02760) | - | 551348..551980 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| L2Z36_RS02765 (L2Z36_02765) | - | 552053..552502 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| L2Z36_RS02770 (L2Z36_02770) | - | 552499..553026 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| L2Z36_RS02775 (L2Z36_02775) | - | 553023..553853 (-) | 831 | WP_059245620.1 | N-acetylmuramidase family protein | - |
| L2Z36_RS02780 (L2Z36_02780) | - | 553850..554119 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| L2Z36_RS02785 (L2Z36_02785) | - | 554116..554466 (-) | 351 | WP_001114936.1 | putative holin | - |
| L2Z36_RS02790 (L2Z36_02790) | - | 554475..554684 (-) | 210 | WP_000659474.1 | tail protein X | - |
| L2Z36_RS02795 (L2Z36_02795) | - | 554685..555137 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| L2Z36_RS02800 (L2Z36_02800) | gpM | 555241..555987 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| L2Z36_RS02805 (L2Z36_02805) | - | 555998..556987 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| L2Z36_RS02810 (L2Z36_02810) | - | 557040..557867 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| L2Z36_RS02815 (L2Z36_02815) | - | 558005..559813 (+) | 1809 | WP_000289874.1 | terminase family protein | - |
| L2Z36_RS02820 (L2Z36_02820) | - | 559813..560811 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=649554 L2Z36_RS02635 WP_002014678.1 531841..532194(-) (ssb) [Acinetobacter baumannii strain AB227-VUB]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=649554 L2Z36_RS02635 WP_002014678.1 531841..532194(-) (ssb) [Acinetobacter baumannii strain AB227-VUB]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |