Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | L2Z38_RS02635 | Genome accession | NZ_CP091339 |
| Coordinates | 531842..532195 (-) | Length | 117 a.a. |
| NCBI ID | WP_002014678.1 | Uniprot ID | A0A0D5YEH0 |
| Organism | Acinetobacter baumannii strain AB229-VUB | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 529476..560812 | 531842..532195 | within | 0 |
Gene organization within MGE regions
Location: 529476..560812
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| L2Z38_RS02615 (L2Z38_02615) | - | 529476..530543 (+) | 1068 | WP_000107854.1 | site-specific integrase | - |
| L2Z38_RS02620 (L2Z38_02620) | - | 530571..530867 (-) | 297 | WP_000218943.1 | hypothetical protein | - |
| L2Z38_RS02625 (L2Z38_02625) | - | 530864..531085 (-) | 222 | WP_000424605.1 | hypothetical protein | - |
| L2Z38_RS02630 (L2Z38_02630) | - | 531095..531832 (-) | 738 | WP_000125747.1 | 3'-5' exonuclease | - |
| L2Z38_RS02635 (L2Z38_02635) | ssb | 531842..532195 (-) | 354 | WP_002014678.1 | single-stranded DNA-binding protein | Machinery gene |
| L2Z38_RS02640 (L2Z38_02640) | - | 532183..532500 (-) | 318 | WP_000049658.1 | hypothetical protein | - |
| L2Z38_RS02645 (L2Z38_02645) | - | 532493..532663 (-) | 171 | WP_001015076.1 | hypothetical protein | - |
| L2Z38_RS02650 (L2Z38_02650) | - | 532653..533204 (-) | 552 | WP_001178668.1 | hypothetical protein | - |
| L2Z38_RS02655 (L2Z38_02655) | - | 533270..533602 (-) | 333 | WP_000632296.1 | hypothetical protein | - |
| L2Z38_RS02660 (L2Z38_02660) | - | 533599..536337 (-) | 2739 | WP_002014340.1 | toprim domain-containing protein | - |
| L2Z38_RS02665 (L2Z38_02665) | - | 536431..536622 (-) | 192 | WP_001043481.1 | hypothetical protein | - |
| L2Z38_RS02670 (L2Z38_02670) | - | 536715..537056 (+) | 342 | WP_000786719.1 | helix-turn-helix transcriptional regulator | - |
| L2Z38_RS02675 (L2Z38_02675) | - | 537101..537316 (-) | 216 | WP_000556351.1 | hypothetical protein | - |
| L2Z38_RS02680 (L2Z38_02680) | - | 537441..538256 (-) | 816 | WP_001094886.1 | Rha family transcriptional regulator | - |
| L2Z38_RS02685 (L2Z38_02685) | - | 538364..538558 (-) | 195 | WP_000696053.1 | hypothetical protein | - |
| L2Z38_RS02690 (L2Z38_02690) | - | 538868..539746 (+) | 879 | WP_000417952.1 | BRCT domain-containing protein | - |
| L2Z38_RS02695 (L2Z38_02695) | - | 539746..540027 (+) | 282 | WP_000713873.1 | hypothetical protein | - |
| L2Z38_RS02700 (L2Z38_02700) | - | 540343..540543 (-) | 201 | WP_000130085.1 | TraR/DksA C4-type zinc finger protein | - |
| L2Z38_RS02705 (L2Z38_02705) | - | 540540..540779 (-) | 240 | WP_000113725.1 | ogr/Delta-like zinc finger family protein | - |
| L2Z38_RS02710 (L2Z38_02710) | - | 540909..542222 (-) | 1314 | WP_000483061.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| L2Z38_RS02715 (L2Z38_02715) | - | 542223..542663 (-) | 441 | WP_000979757.1 | phage tail protein | - |
| L2Z38_RS02720 (L2Z38_02720) | - | 542669..545119 (-) | 2451 | WP_000774268.1 | phage tail tape measure protein | - |
| L2Z38_RS18490 | - | 545133..545246 (-) | 114 | WP_002013839.1 | GpE family phage tail protein | - |
| L2Z38_RS02725 (L2Z38_02725) | - | 545273..545614 (-) | 342 | WP_001071615.1 | phage tail assembly protein | - |
| L2Z38_RS02730 (L2Z38_02730) | - | 545681..546199 (-) | 519 | WP_001207612.1 | phage major tail tube protein | - |
| L2Z38_RS02735 (L2Z38_02735) | - | 546212..547387 (-) | 1176 | WP_000963361.1 | phage tail sheath protein | - |
| L2Z38_RS02740 (L2Z38_02740) | - | 547537..549489 (-) | 1953 | WP_000729646.1 | phage tail protein | - |
| L2Z38_RS02745 (L2Z38_02745) | - | 549501..550106 (-) | 606 | WP_001050805.1 | phage tail protein I | - |
| L2Z38_RS02750 (L2Z38_02750) | - | 550106..551008 (-) | 903 | WP_000109738.1 | baseplate J/gp47 family protein | - |
| L2Z38_RS02755 (L2Z38_02755) | - | 551005..551352 (-) | 348 | WP_000987745.1 | GPW/gp25 family protein | - |
| L2Z38_RS02760 (L2Z38_02760) | - | 551349..551981 (-) | 633 | WP_000990625.1 | phage baseplate assembly protein V | - |
| L2Z38_RS02765 (L2Z38_02765) | - | 552054..552503 (-) | 450 | WP_001059843.1 | phage virion morphogenesis protein | - |
| L2Z38_RS02770 (L2Z38_02770) | - | 552500..553027 (-) | 528 | WP_000742888.1 | phage tail protein | - |
| L2Z38_RS02775 (L2Z38_02775) | - | 553024..553854 (-) | 831 | WP_059245620.1 | N-acetylmuramidase family protein | - |
| L2Z38_RS02780 (L2Z38_02780) | - | 553851..554120 (-) | 270 | WP_000571491.1 | phage holin family protein | - |
| L2Z38_RS02785 (L2Z38_02785) | - | 554117..554467 (-) | 351 | WP_001114936.1 | putative holin | - |
| L2Z38_RS02790 (L2Z38_02790) | - | 554476..554685 (-) | 210 | WP_000659474.1 | tail protein X | - |
| L2Z38_RS02795 (L2Z38_02795) | - | 554686..555138 (-) | 453 | WP_000015691.1 | head completion/stabilization protein | - |
| L2Z38_RS02800 (L2Z38_02800) | gpM | 555242..555988 (-) | 747 | WP_000950641.1 | phage terminase small subunit | - |
| L2Z38_RS02805 (L2Z38_02805) | - | 555999..556988 (-) | 990 | WP_001243259.1 | phage major capsid protein, P2 family | - |
| L2Z38_RS02810 (L2Z38_02810) | - | 557041..557868 (-) | 828 | WP_000748563.1 | GPO family capsid scaffolding protein | - |
| L2Z38_RS02815 (L2Z38_02815) | - | 558006..559814 (+) | 1809 | WP_000289874.1 | terminase family protein | - |
| L2Z38_RS02820 (L2Z38_02820) | - | 559814..560812 (+) | 999 | WP_001284079.1 | phage portal protein | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13365.13 Da Isoelectric Point: 9.7939
>NTDB_id=649506 L2Z38_RS02635 WP_002014678.1 531842..532195(-) (ssb) [Acinetobacter baumannii strain AB229-VUB]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=649506 L2Z38_RS02635 WP_002014678.1 531842..532195(-) (ssb) [Acinetobacter baumannii strain AB229-VUB]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACTGAGTGGC
ATCGGATTGTGGCTCACAACCGCCTAGGTGAAATTGCCTGTCAATTTCTCAAAAAAGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACCCGGAAATGGACTGACCAAAATAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
55.455 |
94.017 |
0.521 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |