Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   LT978_RS04595 Genome accession   NZ_CP090838
Coordinates   904687..904827 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain TL106     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 899687..909827
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT978_RS04570 (LT978_04565) - 899993..900391 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  LT978_RS04575 (LT978_04570) - 900488..901039 (+) 552 WP_052586496.1 isochorismatase family cysteine hydrolase -
  LT978_RS04580 (LT978_04575) - 901057..902523 (+) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  LT978_RS04585 (LT978_04580) - 902653..903873 (+) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  LT978_RS04590 (LT978_04585) - 903880..904221 (-) 342 WP_014305721.1 hypothetical protein -
  LT978_RS04595 (LT978_04590) degQ 904687..904827 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  LT978_RS04600 (LT978_04595) comQ 904958..905944 (+) 987 WP_269321599.1 class 1 isoprenoid biosynthesis enzyme Regulator
  LT978_RS04605 (LT978_04600) comX 905907..906077 (+) 171 WP_003152048.1 competence pheromone ComX Regulator
  LT978_RS04610 (LT978_04605) comP 906097..908400 (+) 2304 WP_003152050.1 histidine kinase Regulator
  LT978_RS04615 (LT978_04610) comA 908481..909125 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  LT978_RS04620 (LT978_04615) - 909147..909530 (+) 384 WP_003152054.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=645043 LT978_RS04595 WP_003152043.1 904687..904827(+) (degQ) [Bacillus amyloliquefaciens strain TL106]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=645043 LT978_RS04595 WP_003152043.1 904687..904827(+) (degQ) [Bacillus amyloliquefaciens strain TL106]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891