Detailed information NTG0643971

Bioinformatically predicted

Overview

• Name: ssb
• Type: Machinery gene
• Locus tag: LZG50_RS19850
• Genome accession: NZ_CP090611
• Coordinates: 4022292..4022828 (-)
• Length: 178 a.a.
• NCBI ID: WP_000168305.1
• Uniprot ID: A0A9P2PPK2
• Organism: Escherichia coli isolate DCE7
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4020793..4036671	4022292..4022828	within	0

Gene organization within MGE regions

Location: 4020793..4036671

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LZG50_RS19845 (LZG50_19845)	-	4020793..4022079 (+)	1287	WP_001591357.1	anaerobic C4-dicarboxylate transporter family protein	-
LZG50_RS19850 (LZG50_19850)	ssb	4022292..4022828 (-)	537	WP_000168305.1	single-stranded DNA-binding protein SSB1	Machinery gene
LZG50_RS19855 (LZG50_19855)	uvrA	4023083..4025905 (+)	2823	WP_096891060.1	excinuclease ABC subunit UvrA	-
LZG50_RS19860 (LZG50_19860)	yjbR	4025940..4026296 (-)	357	WP_000155657.1	MmcQ/YjbR family DNA-binding protein	-
LZG50_RS19865 (LZG50_19865)	yjbQ	4026300..4026716 (-)	417	WP_096841146.1	secondary thiamine-phosphate synthase enzyme YjbQ	-
LZG50_RS19870 (LZG50_19870)	aphA	4026827..4027540 (-)	714	WP_001226928.1	acid phosphatase AphA	-
LZG50_RS19875 (LZG50_19875)	-	4027941..4028303 (+)	363	Protein_3906	hypothetical protein	-
LZG50_RS19880 (LZG50_19880)	tyrB	4028667..4029860 (-)	1194	WP_096841143.1	aromatic amino acid transaminase	-
LZG50_RS19885 (LZG50_19885)	alr	4030113..4031192 (-)	1080	WP_001147328.1	alanine racemase	-
LZG50_RS19890 (LZG50_19890)	dnaB	4031245..4032660 (-)	1416	WP_000918363.1	replicative DNA helicase	-
LZG50_RS19895 (LZG50_19895)	qorA	4032743..4033726 (+)	984	WP_096891061.1	quinone oxidoreductase	-
LZG50_RS19900 (LZG50_19900)	pspG	4033892..4034134 (-)	243	WP_000891408.1	envelope stress response protein PspG	-
LZG50_RS19905 (LZG50_19905)	dusA	4034268..4035305 (-)	1038	WP_001298868.1	tRNA dihydrouridine(20/20a) synthase DusA	-
LZG50_RS19910 (LZG50_19910)	-	4035667..4036671 (-)	1005	WP_075861863.1	DUF2713 family protein	-

Sequence

Protein

• Length: 178 a.a.
• Molecular weight: 18975.00 Da
• Isoelectric Point: 5.2358

>NTDB_id=643971 LZG50_RS19850 WP_000168305.1 4022292..4022828(-) (ssb) [Escherichia coli isolate DCE7]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF

Nucleotide

• Length: 537 bp

>NTDB_id=643971 LZG50_RS19850 WP_000168305.1 4022292..4022828(-) (ssb) [Escherichia coli isolate DCE7]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAGCAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCCAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATT
GAAGGTCAGCTGCGTACCCGCAAATGGACCGATCAATCCGGCCAGGATCGCTATACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGTTGGGTGGTCGTCAGGGTGGTGGCGCTCCTGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCC
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGATTTTGATGACGACATTCCGTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (6-112)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssb	Vibrio cholerae strain A1552	74.444	100	0.753
ssb	Glaesserella parasuis strain SC1401	57.923	100	0.596
ssb	Neisseria meningitidis MC58	48.066	100	0.489
ssb	Neisseria gonorrhoeae MS11	48.066	100	0.489