Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LZ756_RS10870 | Genome accession | NZ_CP090547 |
| Coordinates | 2247955..2248401 (+) | Length | 148 a.a. |
| NCBI ID | WP_020852950.1 | Uniprot ID | A0A060H1M4 |
| Organism | Xylella fastidiosa subsp. sandyi strain OC8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2233047..2273605 | 2247955..2248401 | within | 0 |
Gene organization within MGE regions
Location: 2233047..2273605
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ756_RS10745 (LZ756_10745) | - | 2233047..2233562 (-) | 516 | WP_020852292.1 | phage portal protein | - |
| LZ756_RS10750 (LZ756_10750) | - | 2233559..2233795 (-) | 237 | WP_024749052.1 | hypothetical protein | - |
| LZ756_RS10755 (LZ756_10755) | - | 2233872..2235971 (-) | 2100 | WP_042836615.1 | phage terminase large subunit family protein | - |
| LZ756_RS10760 (LZ756_10760) | - | 2235968..2236567 (-) | 600 | WP_020853062.1 | hypothetical protein | - |
| LZ756_RS10765 (LZ756_10765) | - | 2236964..2238469 (-) | 1506 | WP_042836619.1 | VapE domain-containing protein | - |
| LZ756_RS10770 (LZ756_10770) | - | 2238466..2239521 (-) | 1056 | WP_234759323.1 | DNA primase | - |
| LZ756_RS10775 (LZ756_10775) | - | 2239520..2239921 (+) | 402 | WP_234759325.1 | hypothetical protein | - |
| LZ756_RS10780 (LZ756_10780) | - | 2240023..2240646 (-) | 624 | WP_234759326.1 | hypothetical protein | - |
| LZ756_RS10785 (LZ756_10785) | - | 2240704..2241054 (-) | 351 | WP_042836623.1 | hypothetical protein | - |
| LZ756_RS10790 (LZ756_10790) | - | 2241041..2241337 (-) | 297 | WP_042836624.1 | transcriptional regulator | - |
| LZ756_RS10795 (LZ756_10795) | - | 2241414..2241845 (+) | 432 | WP_004086786.1 | hypothetical protein | - |
| LZ756_RS10800 (LZ756_10800) | - | 2241960..2242427 (+) | 468 | WP_042836716.1 | hypothetical protein | - |
| LZ756_RS10805 (LZ756_10805) | - | 2242633..2242941 (-) | 309 | WP_051604013.1 | hypothetical protein | - |
| LZ756_RS10810 (LZ756_10810) | - | 2242980..2243258 (-) | 279 | WP_230577808.1 | hypothetical protein | - |
| LZ756_RS10815 (LZ756_10815) | - | 2243444..2243842 (+) | 399 | WP_042836626.1 | hypothetical protein | - |
| LZ756_RS10820 (LZ756_10820) | - | 2244076..2244564 (-) | 489 | WP_020853051.1 | hypothetical protein | - |
| LZ756_RS13370 | - | 2244558..2244680 (+) | 123 | WP_267959251.1 | hypothetical protein | - |
| LZ756_RS10825 (LZ756_10825) | - | 2244732..2245019 (+) | 288 | WP_020853052.1 | hypothetical protein | - |
| LZ756_RS10830 (LZ756_10830) | - | 2245003..2245482 (+) | 480 | WP_020853053.1 | DUF1566 domain-containing protein | - |
| LZ756_RS10835 (LZ756_10835) | - | 2245479..2245928 (+) | 450 | WP_020852697.1 | hypothetical protein | - |
| LZ756_RS10840 (LZ756_10840) | - | 2245925..2246146 (+) | 222 | WP_021358638.1 | hypothetical protein | - |
| LZ756_RS10845 (LZ756_10845) | - | 2246143..2246421 (+) | 279 | WP_020853056.1 | hypothetical protein | - |
| LZ756_RS10850 (LZ756_10850) | - | 2246418..2246684 (+) | 267 | WP_020853057.1 | hypothetical protein | - |
| LZ756_RS10855 (LZ756_10855) | - | 2246816..2247349 (+) | 534 | WP_020853058.1 | pilin | - |
| LZ756_RS13460 | - | 2247442..2247606 (+) | 165 | Protein_2133 | UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase | - |
| LZ756_RS10865 (LZ756_10865) | - | 2247765..2247971 (+) | 207 | WP_230577747.1 | hypothetical protein | - |
| LZ756_RS10870 (LZ756_10870) | ssb | 2247955..2248401 (+) | 447 | WP_020852950.1 | single-stranded DNA-binding protein | Machinery gene |
| LZ756_RS10875 (LZ756_10875) | - | 2248423..2248695 (+) | 273 | WP_020852746.1 | hypothetical protein | - |
| LZ756_RS10880 (LZ756_10880) | - | 2248695..2249834 (+) | 1140 | Protein_2137 | integrase | - |
| LZ756_RS10885 (LZ756_10885) | - | 2250258..2250731 (+) | 474 | WP_020852945.1 | DUF488 domain-containing protein | - |
| LZ756_RS10890 (LZ756_10890) | - | 2250688..2251521 (-) | 834 | WP_020852944.1 | hypothetical protein | - |
| LZ756_RS10895 (LZ756_10895) | - | 2252080..2252628 (+) | 549 | WP_024749081.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| LZ756_RS10900 (LZ756_10900) | - | 2252588..2253184 (+) | 597 | WP_024749080.1 | hypothetical protein | - |
| LZ756_RS10905 (LZ756_10905) | - | 2253201..2253425 (+) | 225 | WP_230577809.1 | hypothetical protein | - |
| LZ756_RS10910 (LZ756_10910) | - | 2253426..2254589 (-) | 1164 | WP_020851649.1 | tail fiber protein | - |
| LZ756_RS10915 (LZ756_10915) | - | 2254593..2255153 (-) | 561 | WP_020851650.1 | DUF2612 domain-containing protein | - |
| LZ756_RS10920 (LZ756_10920) | - | 2255150..2255653 (-) | 504 | WP_234759328.1 | hypothetical protein | - |
| LZ756_RS10925 (LZ756_10925) | - | 2255632..2256294 (-) | 663 | WP_234759329.1 | baseplate J/gp47 family protein | - |
| LZ756_RS10930 (LZ756_10930) | - | 2256393..2256689 (+) | 297 | WP_004089252.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LZ756_RS10935 (LZ756_10935) | - | 2256693..2256998 (+) | 306 | WP_004089254.1 | addiction module antidote protein | - |
| LZ756_RS10940 (LZ756_10940) | - | 2257009..2257362 (-) | 354 | WP_020851652.1 | hypothetical protein | - |
| LZ756_RS10945 (LZ756_10945) | - | 2257359..2258000 (-) | 642 | WP_234759331.1 | Gp138 family membrane-puncturing spike protein | - |
| LZ756_RS10950 (LZ756_10950) | - | 2257997..2258827 (-) | 831 | WP_042836628.1 | hypothetical protein | - |
| LZ756_RS10955 (LZ756_10955) | - | 2258824..2259141 (-) | 318 | WP_020851655.1 | hypothetical protein | - |
| LZ756_RS10960 (LZ756_10960) | - | 2259141..2259911 (-) | 771 | WP_024749165.1 | phage baseplate protein | - |
| LZ756_RS10965 (LZ756_10965) | - | 2259969..2260295 (+) | 327 | WP_004091353.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LZ756_RS10970 (LZ756_10970) | - | 2260292..2260573 (+) | 282 | WP_004091355.1 | XRE family transcriptional regulator | - |
| LZ756_RS10975 (LZ756_10975) | - | 2260632..2260925 (-) | 294 | Protein_2156 | hypothetical protein | - |
| LZ756_RS10980 (LZ756_10980) | - | 2260927..2261148 (-) | 222 | Protein_2157 | phage baseplate protein | - |
| LZ756_RS10985 (LZ756_10985) | - | 2261236..2261535 (+) | 300 | WP_024749166.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LZ756_RS10990 (LZ756_10990) | - | 2261539..2261847 (+) | 309 | WP_004085003.1 | addiction module antidote protein | - |
| LZ756_RS10995 (LZ756_10995) | - | 2261921..2263810 (-) | 1890 | WP_042836631.1 | hypothetical protein | - |
| LZ756_RS11000 (LZ756_11000) | - | 2263767..2263931 (-) | 165 | WP_162849007.1 | hypothetical protein | - |
| LZ756_RS11005 (LZ756_11005) | - | 2263958..2264380 (-) | 423 | WP_020852390.1 | phage tail assembly chaperone | - |
| LZ756_RS11010 (LZ756_11010) | - | 2264377..2264814 (-) | 438 | WP_004087249.1 | phage protein | - |
| LZ756_RS11015 (LZ756_11015) | - | 2264824..2265051 (-) | 228 | WP_080702514.1 | DUF3383 family protein | - |
| LZ756_RS11020 (LZ756_11020) | - | 2265277..2266146 (-) | 870 | WP_020851662.1 | RNA-guided endonuclease TnpB family protein | - |
| LZ756_RS11025 (LZ756_11025) | - | 2266125..2266433 (-) | 309 | WP_020851663.1 | helix-turn-helix domain-containing protein | - |
| LZ756_RS11030 (LZ756_11030) | - | 2266465..2267082 (-) | 618 | Protein_2167 | IS607 family transposase | - |
| LZ756_RS11035 (LZ756_11035) | - | 2267154..2267753 (+) | 600 | WP_020851666.1 | hypothetical protein | - |
| LZ756_RS11040 (LZ756_11040) | - | 2267750..2268028 (+) | 279 | WP_020851667.1 | VRR-NUC domain-containing protein | - |
| LZ756_RS11045 (LZ756_11045) | - | 2268030..2268320 (-) | 291 | WP_038274391.1 | hypothetical protein | - |
| LZ756_RS11050 (LZ756_11050) | - | 2268390..2268836 (-) | 447 | WP_024749168.1 | hypothetical protein | - |
| LZ756_RS11055 (LZ756_11055) | - | 2268921..2270339 (+) | 1419 | WP_020852570.1 | DEAD/DEAH box helicase | - |
| LZ756_RS11060 (LZ756_11060) | - | 2270336..2270581 (+) | 246 | WP_080702516.1 | DUF4224 domain-containing protein | - |
| LZ756_RS11065 (LZ756_11065) | - | 2270581..2271600 (+) | 1020 | WP_020852569.1 | tyrosine-type recombinase/integrase | - |
| LZ756_RS11070 (LZ756_11070) | - | 2271668..2273605 (-) | 1938 | WP_020852568.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16605.49 Da Isoelectric Point: 7.3543
>NTDB_id=643406 LZ756_RS10870 WP_020852950.1 2247955..2248401(+) (ssb) [Xylella fastidiosa subsp. sandyi strain OC8]
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIANQMHMLGGRGEGSSGITPQQRPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIANQMHMLGGRGEGSSGITPQQRPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=643406 LZ756_RS10870 WP_020852950.1 2247955..2248401(+) (ssb) [Xylella fastidiosa subsp. sandyi strain OC8]
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTAACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGCATCACGCCACAGCAGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTAACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGCATCACGCCACAGCAGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
42.045 |
100 |
0.5 |
| ssb | Neisseria meningitidis MC58 |
39.306 |
100 |
0.459 |
| ssb | Neisseria gonorrhoeae MS11 |
39.306 |
100 |
0.459 |
| ssb | Glaesserella parasuis strain SC1401 |
42.029 |
93.243 |
0.392 |