Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LZ756_RS03920 | Genome accession | NZ_CP090547 |
| Coordinates | 891142..891588 (-) | Length | 148 a.a. |
| NCBI ID | WP_020852692.1 | Uniprot ID | A0A060H9R4 |
| Organism | Xylella fastidiosa subsp. sandyi strain OC8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 888834..930603 | 891142..891588 | within | 0 |
Gene organization within MGE regions
Location: 888834..930603
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ756_RS03900 (LZ756_03900) | queC | 888834..889526 (+) | 693 | WP_020852689.1 | 7-cyano-7-deazaguanine synthase QueC | - |
| LZ756_RS03910 (LZ756_03910) | - | 889664..890848 (-) | 1185 | WP_024749268.1 | hypothetical protein | - |
| LZ756_RS03915 (LZ756_03915) | - | 890848..891123 (-) | 276 | WP_038274650.1 | hypothetical protein | - |
| LZ756_RS03920 (LZ756_03920) | ssb | 891142..891588 (-) | 447 | WP_020852692.1 | single-stranded DNA-binding protein | Machinery gene |
| LZ756_RS03925 (LZ756_03925) | - | 891572..891778 (-) | 207 | WP_230577747.1 | hypothetical protein | - |
| LZ756_RS13425 | - | 891937..892101 (-) | 165 | Protein_753 | UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase | - |
| LZ756_RS03935 (LZ756_03935) | - | 892194..892727 (-) | 534 | WP_020852695.1 | pilin | - |
| LZ756_RS03940 (LZ756_03940) | - | 892705..892866 (-) | 162 | WP_196242785.1 | hypothetical protein | - |
| LZ756_RS03945 (LZ756_03945) | - | 892859..893125 (-) | 267 | WP_020853057.1 | hypothetical protein | - |
| LZ756_RS03950 (LZ756_03950) | - | 893122..893400 (-) | 279 | WP_020853056.1 | hypothetical protein | - |
| LZ756_RS03955 (LZ756_03955) | - | 893397..893618 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| LZ756_RS03960 (LZ756_03960) | - | 893615..894064 (-) | 450 | WP_020852697.1 | hypothetical protein | - |
| LZ756_RS03965 (LZ756_03965) | - | 894061..894531 (-) | 471 | WP_020852698.1 | DUF1566 domain-containing protein | - |
| LZ756_RS03970 (LZ756_03970) | - | 894528..894989 (-) | 462 | WP_024748647.1 | hypothetical protein | - |
| LZ756_RS03975 (LZ756_03975) | - | 895097..895642 (-) | 546 | WP_024749191.1 | hypothetical protein | - |
| LZ756_RS03980 (LZ756_03980) | - | 895705..896103 (-) | 399 | WP_020852700.1 | hypothetical protein | - |
| LZ756_RS03985 (LZ756_03985) | - | 896326..897057 (-) | 732 | WP_155244272.1 | hypothetical protein | - |
| LZ756_RS03990 (LZ756_03990) | - | 897668..898627 (-) | 960 | WP_230577748.1 | helix-turn-helix transcriptional regulator | - |
| LZ756_RS03995 (LZ756_03995) | - | 898755..898994 (+) | 240 | WP_020852703.1 | helix-turn-helix domain-containing protein | - |
| LZ756_RS04000 (LZ756_04000) | - | 898981..899331 (+) | 351 | WP_230577749.1 | hypothetical protein | - |
| LZ756_RS04005 (LZ756_04005) | - | 899389..900012 (+) | 624 | WP_020852705.1 | hypothetical protein | - |
| LZ756_RS04010 (LZ756_04010) | - | 900114..900515 (-) | 402 | WP_024748708.1 | hypothetical protein | - |
| LZ756_RS04015 (LZ756_04015) | - | 900514..901569 (+) | 1056 | WP_020851153.1 | DNA primase | - |
| LZ756_RS04020 (LZ756_04020) | - | 901566..903035 (+) | 1470 | WP_020851152.1 | VapE domain-containing protein | - |
| LZ756_RS04025 (LZ756_04025) | - | 903432..904040 (+) | 609 | WP_020851151.1 | hypothetical protein | - |
| LZ756_RS04030 (LZ756_04030) | - | 904037..906448 (+) | 2412 | WP_234759304.1 | phage terminase large subunit family protein | - |
| LZ756_RS04035 (LZ756_04035) | - | 906333..908006 (+) | 1674 | WP_234759371.1 | phage portal protein | - |
| LZ756_RS04040 (LZ756_04040) | - | 908097..910316 (+) | 2220 | WP_234759374.1 | ClpP-like prohead protease/major capsid protein fusion protein | - |
| LZ756_RS04045 (LZ756_04045) | - | 910389..910529 (+) | 141 | WP_020851146.1 | capsid cement protein | - |
| LZ756_RS04050 (LZ756_04050) | - | 910501..910761 (+) | 261 | WP_020851145.1 | capsid cement protein | - |
| LZ756_RS04055 (LZ756_04055) | - | 910833..911057 (+) | 225 | WP_024748645.1 | hypothetical protein | - |
| LZ756_RS04060 (LZ756_04060) | - | 911050..911631 (+) | 582 | WP_020851144.1 | lysozyme | - |
| LZ756_RS04065 (LZ756_04065) | - | 911631..911774 (+) | 144 | WP_155244210.1 | hypothetical protein | - |
| LZ756_RS04070 (LZ756_04070) | - | 911771..912556 (+) | 786 | WP_024748523.1 | hypothetical protein | - |
| LZ756_RS04075 (LZ756_04075) | - | 912553..912873 (+) | 321 | WP_004086810.1 | hypothetical protein | - |
| LZ756_RS04080 (LZ756_04080) | - | 912870..913343 (+) | 474 | WP_020851142.1 | hypothetical protein | - |
| LZ756_RS04085 (LZ756_04085) | - | 913340..914089 (+) | 750 | WP_020851141.1 | hypothetical protein | - |
| LZ756_RS04090 (LZ756_04090) | - | 914086..914532 (+) | 447 | WP_020851140.1 | DUF6631 family protein | - |
| LZ756_RS04095 (LZ756_04095) | - | 914529..914696 (+) | 168 | WP_004086814.1 | hypothetical protein | - |
| LZ756_RS04100 (LZ756_04100) | - | 914697..917210 (+) | 2514 | WP_020851139.1 | hypothetical protein | - |
| LZ756_RS04105 (LZ756_04105) | - | 917203..918390 (+) | 1188 | WP_020851138.1 | hypothetical protein | - |
| LZ756_RS04110 (LZ756_04110) | - | 918380..919822 (+) | 1443 | WP_020851137.1 | DUF2163 domain-containing protein | - |
| LZ756_RS04115 (LZ756_04115) | - | 919813..920241 (+) | 429 | WP_004086822.1 | hypothetical protein | - |
| LZ756_RS04120 (LZ756_04120) | - | 920238..920474 (+) | 237 | WP_004087265.1 | hypothetical protein | - |
| LZ756_RS04125 (LZ756_04125) | - | 920464..923289 (+) | 2826 | WP_042836516.1 | vWA domain-containing protein | - |
| LZ756_RS04130 (LZ756_04130) | - | 923282..923794 (+) | 513 | WP_020851135.1 | hypothetical protein | - |
| LZ756_RS04135 (LZ756_04135) | - | 923798..924217 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| LZ756_RS04140 (LZ756_04140) | - | 924317..924988 (+) | 672 | WP_230577751.1 | hypothetical protein | - |
| LZ756_RS04145 (LZ756_04145) | - | 924985..925326 (+) | 342 | WP_020852814.1 | rhomboid family intramembrane serine protease | - |
| LZ756_RS04150 (LZ756_04150) | - | 925476..926480 (+) | 1005 | WP_020852813.1 | hypothetical protein | - |
| LZ756_RS04155 (LZ756_04155) | - | 926913..927206 (-) | 294 | WP_234759377.1 | BrnA antitoxin family protein | - |
| LZ756_RS04160 (LZ756_04160) | - | 927190..927477 (-) | 288 | WP_004083921.1 | BrnT family toxin | - |
| LZ756_RS04165 (LZ756_04165) | - | 927755..928096 (-) | 342 | WP_004084103.1 | helix-turn-helix transcriptional regulator | - |
| LZ756_RS04170 (LZ756_04170) | - | 928628..928882 (-) | 255 | WP_020852812.1 | HigA family addiction module antitoxin | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16692.56 Da Isoelectric Point: 6.8732
>NTDB_id=643397 LZ756_RS03920 WP_020852692.1 891142..891588(-) (ssb) [Xylella fastidiosa subsp. sandyi strain OC8]
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRRPAKVRNNDKAYAYADDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITNISLATSSKRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRRPAKVRNNDKAYAYADDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=643397 LZ756_RS03920 WP_020852692.1 891142..891588(-) (ssb) [Xylella fastidiosa subsp. sandyi strain OC8]
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGCATCACGCCACAGCGGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGACGACGACTTCCACGATGACGACATCCCGTTCTAG
ATGGCACGCGGAATTAACAAGGTAATCCTAGTCGGCAACCTGGGGAACGAGCCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAACATTAGCCTAGCAACCAGCAGCAAACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCACAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAATTCACCGGCAATGATGGGCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGCATCACGCCACAGCGGCGACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGACGACGACTTCCACGATGACGACATCCCGTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
37.64 |
100 |
0.453 |