Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LZ751_RS02955 | Genome accession | NZ_CP090513 |
| Coordinates | 693855..694301 (-) | Length | 148 a.a. |
| NCBI ID | WP_021358633.1 | Uniprot ID | - |
| Organism | Xylella fastidiosa subsp. multiplex strain Red Oak 8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 684913..713242 | 693855..694301 | within | 0 |
Gene organization within MGE regions
Location: 684913..713242
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ751_RS02905 (LZ751_02905) | - | 684955..685539 (+) | 585 | WP_004083991.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| LZ751_RS02910 (LZ751_02910) | - | 685734..686375 (-) | 642 | WP_004083987.1 | ABC-type transport auxiliary lipoprotein family protein | - |
| LZ751_RS02915 (LZ751_02915) | - | 686372..687298 (-) | 927 | WP_004083985.1 | MlaD family protein | - |
| LZ751_RS02920 (LZ751_02920) | - | 687302..688132 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| LZ751_RS02925 (LZ751_02925) | - | 688138..689256 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| LZ751_RS02930 (LZ751_02930) | - | 689366..690628 (+) | 1263 | WP_012337721.1 | threonine/serine exporter family protein | - |
| LZ751_RS02935 (LZ751_02935) | - | 691269..691475 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| LZ751_RS02940 (LZ751_02940) | - | 691539..691748 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| LZ751_RS02945 (LZ751_02945) | - | 692389..693561 (-) | 1173 | WP_004083967.1 | integrase | - |
| LZ751_RS02950 (LZ751_02950) | - | 693561..693833 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| LZ751_RS02955 (LZ751_02955) | ssb | 693855..694301 (-) | 447 | WP_021358633.1 | single-stranded DNA-binding protein | Machinery gene |
| LZ751_RS02960 (LZ751_02960) | - | 694285..694755 (-) | 471 | WP_076613218.1 | DUF5131 family protein | - |
| LZ751_RS02965 (LZ751_02965) | - | 694748..694978 (-) | 231 | WP_021358635.1 | hypothetical protein | - |
| LZ751_RS02970 (LZ751_02970) | - | 694978..695511 (-) | 534 | WP_004083962.1 | hypothetical protein | - |
| LZ751_RS02975 (LZ751_02975) | - | 695508..696101 (-) | 594 | WP_004083960.1 | DapH/DapD/GlmU-related protein | - |
| LZ751_RS02980 (LZ751_02980) | - | 696194..696727 (-) | 534 | WP_012337723.1 | pilin | - |
| LZ751_RS02985 (LZ751_02985) | - | 696860..697126 (-) | 267 | WP_004084112.1 | hypothetical protein | - |
| LZ751_RS02990 (LZ751_02990) | - | 697123..697401 (-) | 279 | WP_004083957.1 | hypothetical protein | - |
| LZ751_RS02995 (LZ751_02995) | - | 697398..697619 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| LZ751_RS03000 (LZ751_03000) | - | 697616..698074 (-) | 459 | WP_004084109.1 | hypothetical protein | - |
| LZ751_RS03005 (LZ751_03005) | - | 698071..698535 (-) | 465 | WP_021358639.1 | DUF1566 domain-containing protein | - |
| LZ751_RS03010 (LZ751_03010) | - | 698532..698873 (-) | 342 | WP_228762220.1 | hypothetical protein | - |
| LZ751_RS03015 (LZ751_03015) | - | 699064..699642 (+) | 579 | WP_228762221.1 | hypothetical protein | - |
| LZ751_RS03020 (LZ751_03020) | - | 699744..700145 (-) | 402 | WP_021358642.1 | hypothetical protein | - |
| LZ751_RS03025 (LZ751_03025) | - | 700144..700632 (+) | 489 | WP_021358643.1 | CHC2 zinc finger domain-containing protein | - |
| LZ751_RS03030 (LZ751_03030) | - | 700568..701212 (+) | 645 | WP_228762222.1 | terminase gpA endonuclease subunit | - |
| LZ751_RS03035 (LZ751_03035) | - | 701289..701525 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| LZ751_RS03040 (LZ751_03040) | - | 701522..702037 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| LZ751_RS03045 (LZ751_03045) | - | 702154..702444 (+) | 291 | WP_076613257.1 | hypothetical protein | - |
| LZ751_RS11090 | - | 702458..702580 (+) | 123 | WP_324187556.1 | hypothetical protein | - |
| LZ751_RS03050 (LZ751_03050) | - | 702571..702999 (+) | 429 | WP_004086822.1 | hypothetical protein | - |
| LZ751_RS03055 (LZ751_03055) | - | 702996..703232 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| LZ751_RS03060 (LZ751_03060) | - | 703222..706047 (+) | 2826 | WP_012337728.1 | phage tail protein | - |
| LZ751_RS03065 (LZ751_03065) | - | 706040..706549 (+) | 510 | WP_234556083.1 | hypothetical protein | - |
| LZ751_RS03070 (LZ751_03070) | - | 706553..706972 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| LZ751_RS03075 (LZ751_03075) | - | 707081..707743 (+) | 663 | WP_228762226.1 | hypothetical protein | - |
| LZ751_RS10995 | - | 707803..707931 (-) | 129 | WP_256704593.1 | hypothetical protein | - |
| LZ751_RS03080 (LZ751_03080) | - | 707979..708086 (+) | 108 | Protein_592 | DNA adenine methylase | - |
| LZ751_RS03085 (LZ751_03085) | - | 708138..708764 (+) | 627 | WP_038230952.1 | IS607 family transposase | - |
| LZ751_RS03090 (LZ751_03090) | - | 708758..709954 (+) | 1197 | WP_012337730.1 | RNA-guided endonuclease TnpB family protein | - |
| LZ751_RS03095 (LZ751_03095) | - | 709961..710665 (+) | 705 | WP_154123795.1 | DNA adenine methylase | - |
| LZ751_RS03100 (LZ751_03100) | - | 710922..711320 (-) | 399 | WP_012337731.1 | hypothetical protein | - |
| LZ751_RS03105 (LZ751_03105) | - | 711371..711670 (-) | 300 | WP_004084250.1 | hypothetical protein | - |
| LZ751_RS11000 | - | 711804..711935 (-) | 132 | WP_256704532.1 | hypothetical protein | - |
| LZ751_RS03110 (LZ751_03110) | - | 712030..712272 (-) | 243 | WP_012337732.1 | hypothetical protein | - |
| LZ751_RS03115 (LZ751_03115) | - | 712678..712995 (-) | 318 | WP_004084245.1 | BrnA antitoxin family protein | - |
| LZ751_RS03120 (LZ751_03120) | - | 712955..713242 (-) | 288 | WP_004083921.1 | BrnT family toxin | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16536.38 Da Isoelectric Point: 6.4871
>NTDB_id=643089 LZ751_RS02955 WP_021358633.1 693855..694301(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Red Oak 8]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=643089 LZ751_RS02955 WP_021358633.1 693855..694301(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Red Oak 8]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |