Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LZ754_RS03160 | Genome accession | NZ_CP090511 |
| Coordinates | 719033..719479 (-) | Length | 148 a.a. |
| NCBI ID | WP_038210386.1 | Uniprot ID | A0AAW6HUM6 |
| Organism | Xylella fastidiosa subsp. multiplex strain Oak 35874 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 712204..736137 | 719033..719479 | within | 0 |
Gene organization within MGE regions
Location: 712204..736137
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ754_RS03120 (LZ754_03120) | - | 712204..713034 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| LZ754_RS03125 (LZ754_03125) | - | 713040..714158 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| LZ754_RS03130 (LZ754_03130) | - | 714268..715530 (+) | 1263 | WP_012337721.1 | threonine/serine exporter family protein | - |
| LZ754_RS03135 (LZ754_03135) | - | 716171..716377 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| LZ754_RS03140 (LZ754_03140) | - | 716441..716653 (+) | 213 | WP_228304324.1 | hypothetical protein | - |
| LZ754_RS03145 (LZ754_03145) | - | 716717..716926 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| LZ754_RS03150 (LZ754_03150) | - | 717567..718739 (-) | 1173 | WP_038210388.1 | integrase | - |
| LZ754_RS03155 (LZ754_03155) | - | 718739..719011 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| LZ754_RS03160 (LZ754_03160) | ssb | 719033..719479 (-) | 447 | WP_038210386.1 | single-stranded DNA-binding protein | Machinery gene |
| LZ754_RS03165 (LZ754_03165) | - | 719463..719933 (-) | 471 | WP_071869857.1 | DUF5131 family protein | - |
| LZ754_RS03170 (LZ754_03170) | - | 719926..720156 (-) | 231 | WP_154415128.1 | hypothetical protein | - |
| LZ754_RS03175 (LZ754_03175) | - | 720156..720479 (-) | 324 | WP_038210382.1 | hypothetical protein | - |
| LZ754_RS03180 (LZ754_03180) | - | 720572..721105 (-) | 534 | WP_004086585.1 | pilin | - |
| LZ754_RS03185 (LZ754_03185) | - | 721238..721504 (-) | 267 | WP_027700596.1 | hypothetical protein | - |
| LZ754_RS03190 (LZ754_03190) | - | 721501..721779 (-) | 279 | WP_027700595.1 | hypothetical protein | - |
| LZ754_RS03195 (LZ754_03195) | - | 721776..721997 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| LZ754_RS03200 (LZ754_03200) | - | 721994..722443 (-) | 450 | WP_038210363.1 | hypothetical protein | - |
| LZ754_RS03205 (LZ754_03205) | - | 722443..722901 (-) | 459 | WP_027700592.1 | DUF1566 domain-containing protein | - |
| LZ754_RS03210 (LZ754_03210) | - | 722898..723239 (-) | 342 | WP_228762220.1 | hypothetical protein | - |
| LZ754_RS03215 (LZ754_03215) | - | 723431..724057 (+) | 627 | WP_140160998.1 | IS607 family transposase | - |
| LZ754_RS03220 (LZ754_03220) | - | 724051..725328 (+) | 1278 | WP_234499902.1 | transposase | - |
| LZ754_RS03225 (LZ754_03225) | - | 725315..725662 (+) | 348 | WP_234499903.1 | CHC2 zinc finger domain-containing protein | - |
| LZ754_RS03230 (LZ754_03230) | - | 725598..726242 (+) | 645 | WP_234499904.1 | terminase gpA endonuclease subunit | - |
| LZ754_RS03235 (LZ754_03235) | - | 726319..726555 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| LZ754_RS03240 (LZ754_03240) | - | 726552..727067 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| LZ754_RS03245 (LZ754_03245) | - | 727184..727474 (+) | 291 | WP_076613257.1 | hypothetical protein | - |
| LZ754_RS12390 | - | 727488..727610 (+) | 123 | WP_324187556.1 | hypothetical protein | - |
| LZ754_RS03250 (LZ754_03250) | - | 727601..728029 (+) | 429 | WP_004083945.1 | hypothetical protein | - |
| LZ754_RS03255 (LZ754_03255) | - | 728026..728262 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| LZ754_RS03260 (LZ754_03260) | - | 728252..731077 (+) | 2826 | WP_234499905.1 | phage tail protein | - |
| LZ754_RS03265 (LZ754_03265) | - | 731070..731582 (+) | 513 | WP_169709957.1 | hypothetical protein | - |
| LZ754_RS03270 (LZ754_03270) | - | 731586..732005 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| LZ754_RS03275 (LZ754_03275) | - | 732114..732776 (+) | 663 | WP_234499906.1 | hypothetical protein | - |
| LZ754_RS03280 (LZ754_03280) | - | 732773..733018 (+) | 246 | WP_234499907.1 | hypothetical protein | - |
| LZ754_RS03285 (LZ754_03285) | - | 733011..733802 (+) | 792 | WP_027700039.1 | DNA adenine methylase | - |
| LZ754_RS03290 (LZ754_03290) | - | 734058..734456 (-) | 399 | WP_027700038.1 | hypothetical protein | - |
| LZ754_RS03295 (LZ754_03295) | - | 734513..734812 (-) | 300 | WP_038211041.1 | hypothetical protein | - |
| LZ754_RS03300 (LZ754_03300) | - | 734887..735159 (-) | 273 | WP_027700037.1 | hypothetical protein | - |
| LZ754_RS03305 (LZ754_03305) | - | 735172..735414 (-) | 243 | WP_020851762.1 | hypothetical protein | - |
| LZ754_RS03310 (LZ754_03310) | - | 735820..736137 (-) | 318 | WP_004084245.1 | BrnA antitoxin family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16508.32 Da Isoelectric Point: 6.4865
>NTDB_id=643072 LZ754_RS03160 WP_038210386.1 719033..719479(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Oak 35874]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=643072 LZ754_RS03160 WP_038210386.1 719033..719479(-) (ssb) [Xylella fastidiosa subsp. multiplex strain Oak 35874]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.15 |
100 |
0.446 |
| ssb | Neisseria gonorrhoeae MS11 |
38.15 |
100 |
0.446 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |