Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LZ759_RS02980 | Genome accession | NZ_CP090510 |
| Coordinates | 700828..701274 (-) | Length | 148 a.a. |
| NCBI ID | WP_038210386.1 | Uniprot ID | A0AAW6HUM6 |
| Organism | Xylella fastidiosa subsp. multiplex strain LA-Y3C | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 691610..716038 | 700828..701274 | within | 0 |
Gene organization within MGE regions
Location: 691610..716038
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ759_RS02925 (LZ759_02925) | - | 691652..692236 (+) | 585 | WP_004083991.1 | alpha-ketoglutarate-dependent dioxygenase AlkB | - |
| LZ759_RS02930 (LZ759_02930) | - | 692431..693072 (-) | 642 | WP_004083987.1 | ABC-type transport auxiliary lipoprotein family protein | - |
| LZ759_RS02935 (LZ759_02935) | - | 693069..693995 (-) | 927 | WP_004083985.1 | MlaD family protein | - |
| LZ759_RS02940 (LZ759_02940) | - | 693999..694829 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| LZ759_RS02945 (LZ759_02945) | - | 694835..695953 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| LZ759_RS02950 (LZ759_02950) | - | 696063..697325 (+) | 1263 | WP_012337721.1 | threonine/serine exporter family protein | - |
| LZ759_RS02955 (LZ759_02955) | - | 697966..698172 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| LZ759_RS02960 (LZ759_02960) | - | 698236..698448 (+) | 213 | WP_228304324.1 | hypothetical protein | - |
| LZ759_RS02965 (LZ759_02965) | - | 698512..698721 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| LZ759_RS02970 (LZ759_02970) | - | 699362..700534 (-) | 1173 | WP_038210388.1 | integrase | - |
| LZ759_RS02975 (LZ759_02975) | - | 700534..700806 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| LZ759_RS02980 (LZ759_02980) | ssb | 700828..701274 (-) | 447 | WP_038210386.1 | single-stranded DNA-binding protein | Machinery gene |
| LZ759_RS02985 (LZ759_02985) | - | 701258..701728 (-) | 471 | WP_071869857.1 | DUF5131 family protein | - |
| LZ759_RS02990 (LZ759_02990) | - | 701721..701951 (-) | 231 | WP_154415128.1 | hypothetical protein | - |
| LZ759_RS02995 (LZ759_02995) | - | 701951..702274 (-) | 324 | WP_038210382.1 | hypothetical protein | - |
| LZ759_RS03000 (LZ759_03000) | - | 702367..702900 (-) | 534 | WP_081364569.1 | pilin | - |
| LZ759_RS03005 (LZ759_03005) | - | 703033..703299 (-) | 267 | WP_027700596.1 | hypothetical protein | - |
| LZ759_RS03010 (LZ759_03010) | - | 703296..703574 (-) | 279 | WP_234545851.1 | hypothetical protein | - |
| LZ759_RS03015 (LZ759_03015) | - | 703571..703792 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| LZ759_RS03020 (LZ759_03020) | - | 703789..704238 (-) | 450 | WP_038210363.1 | hypothetical protein | - |
| LZ759_RS03025 (LZ759_03025) | - | 704238..704696 (-) | 459 | WP_027700592.1 | DUF1566 domain-containing protein | - |
| LZ759_RS03030 (LZ759_03030) | - | 704693..705034 (-) | 342 | WP_228762220.1 | hypothetical protein | - |
| LZ759_RS03035 (LZ759_03035) | - | 705215..705562 (+) | 348 | WP_234499903.1 | CHC2 zinc finger domain-containing protein | - |
| LZ759_RS03040 (LZ759_03040) | - | 705498..706142 (+) | 645 | WP_234499904.1 | terminase gpA endonuclease subunit | - |
| LZ759_RS03045 (LZ759_03045) | - | 706219..706455 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| LZ759_RS03050 (LZ759_03050) | - | 706452..706967 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| LZ759_RS03055 (LZ759_03055) | - | 707084..707374 (+) | 291 | WP_081364557.1 | hypothetical protein | - |
| LZ759_RS11255 | - | 707388..707510 (+) | 123 | WP_324187556.1 | hypothetical protein | - |
| LZ759_RS03065 (LZ759_03065) | - | 707624..707929 (+) | 306 | WP_234545853.1 | hypothetical protein | - |
| LZ759_RS03070 (LZ759_03070) | - | 707926..708162 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| LZ759_RS03075 (LZ759_03075) | - | 708152..710977 (+) | 2826 | WP_234545854.1 | phage tail protein | - |
| LZ759_RS03080 (LZ759_03080) | - | 710970..711482 (+) | 513 | WP_071869936.1 | hypothetical protein | - |
| LZ759_RS03085 (LZ759_03085) | - | 711486..711905 (+) | 420 | WP_004087259.1 | hypothetical protein | - |
| LZ759_RS03090 (LZ759_03090) | - | 712014..712676 (+) | 663 | WP_234545855.1 | hypothetical protein | - |
| LZ759_RS11195 | - | 712736..712864 (-) | 129 | WP_256704593.1 | hypothetical protein | - |
| LZ759_RS03095 (LZ759_03095) | - | 712912..713703 (+) | 792 | WP_140161046.1 | DNA adenine methylase | - |
| LZ759_RS03100 (LZ759_03100) | - | 713959..714357 (-) | 399 | WP_027700038.1 | hypothetical protein | - |
| LZ759_RS03105 (LZ759_03105) | - | 714414..714713 (-) | 300 | WP_004084250.1 | hypothetical protein | - |
| LZ759_RS03110 (LZ759_03110) | - | 714788..715060 (-) | 273 | WP_027700037.1 | hypothetical protein | - |
| LZ759_RS03115 (LZ759_03115) | - | 715073..715315 (-) | 243 | WP_020851762.1 | hypothetical protein | - |
| LZ759_RS03120 (LZ759_03120) | - | 715721..716038 (-) | 318 | WP_004084245.1 | BrnA antitoxin family protein | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16508.32 Da Isoelectric Point: 6.4865
>NTDB_id=643055 LZ759_RS02980 WP_038210386.1 700828..701274(-) (ssb) [Xylella fastidiosa subsp. multiplex strain LA-Y3C]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGNDGQDRYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=643055 LZ759_RS02980 WP_038210386.1 700828..701274(-) (ssb) [Xylella fastidiosa subsp. multiplex strain LA-Y3C]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTGGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCAATGATGGCCAGGACCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.15 |
100 |
0.446 |
| ssb | Neisseria gonorrhoeae MS11 |
38.15 |
100 |
0.446 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |