Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LZ757_RS08340 | Genome accession | NZ_CP090506 |
| Coordinates | 1756090..1756584 (-) | Length | 164 a.a. |
| NCBI ID | WP_004089231.1 | Uniprot ID | Q87DQ5 |
| Organism | Xylella fastidiosa subsp. morus strain Riv19 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1752103..1802800 | 1756090..1756584 | within | 0 |
Gene organization within MGE regions
Location: 1752103..1802800
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ757_RS08325 (LZ757_08325) | - | 1752103..1753299 (-) | 1197 | WP_038229878.1 | cation:proton antiporter | - |
| LZ757_RS08330 (LZ757_08330) | - | 1753612..1754442 (-) | 831 | WP_080679699.1 | methyltransferase domain-containing protein | - |
| LZ757_RS08335 (LZ757_08335) | - | 1755651..1755815 (-) | 165 | WP_162832860.1 | hypothetical protein | - |
| LZ757_RS08340 (LZ757_08340) | ssb | 1756090..1756584 (-) | 495 | WP_004089231.1 | single-stranded DNA-binding protein | Machinery gene |
| LZ757_RS08345 (LZ757_08345) | - | 1756835..1757836 (+) | 1002 | WP_038229804.1 | polyprenyl synthetase family protein | - |
| LZ757_RS08350 (LZ757_08350) | cyoA | 1758305..1759264 (+) | 960 | WP_027700012.1 | ubiquinol oxidase subunit II | - |
| LZ757_RS08355 (LZ757_08355) | cyoB | 1759258..1761255 (+) | 1998 | WP_027700013.1 | cytochrome o ubiquinol oxidase subunit I | - |
| LZ757_RS08360 (LZ757_08360) | cyoC | 1761261..1761869 (+) | 609 | WP_004089235.1 | cytochrome o ubiquinol oxidase subunit III | - |
| LZ757_RS08365 (LZ757_08365) | cyoD | 1761869..1762210 (+) | 342 | WP_004089237.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| LZ757_RS08370 (LZ757_08370) | - | 1762506..1763588 (-) | 1083 | WP_234056298.1 | phage late control D family protein | - |
| LZ757_RS08375 (LZ757_08375) | - | 1763579..1763797 (-) | 219 | WP_038230466.1 | tail protein X | - |
| LZ757_RS08380 (LZ757_08380) | - | 1763794..1764276 (-) | 483 | WP_071869466.1 | phage tail protein | - |
| LZ757_RS08385 (LZ757_08385) | - | 1764273..1766492 (-) | 2220 | WP_338126341.1 | phage tail tape measure protein | - |
| LZ757_RS08390 (LZ757_08390) | - | 1766619..1766906 (-) | 288 | WP_012337638.1 | phage tail assembly protein | - |
| LZ757_RS08395 (LZ757_08395) | - | 1766909..1767418 (-) | 510 | WP_012337639.1 | phage major tail tube protein | - |
| LZ757_RS08400 (LZ757_08400) | - | 1767418..1768596 (-) | 1179 | WP_027700434.1 | phage tail sheath family protein | - |
| LZ757_RS08405 (LZ757_08405) | - | 1768661..1770253 (-) | 1593 | WP_040123119.1 | tail fiber domain-containing protein | - |
| LZ757_RS08410 (LZ757_08410) | - | 1770261..1770818 (-) | 558 | WP_027700436.1 | phage tail protein I | - |
| LZ757_RS08415 (LZ757_08415) | - | 1770811..1771704 (-) | 894 | WP_234056296.1 | baseplate J/gp47 family protein | - |
| LZ757_RS08420 (LZ757_08420) | - | 1771704..1772042 (-) | 339 | WP_004088650.1 | GPW/gp25 family protein | - |
| LZ757_RS08425 (LZ757_08425) | - | 1772240..1772521 (+) | 282 | WP_004085174.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LZ757_RS08430 (LZ757_08430) | - | 1772532..1772807 (+) | 276 | WP_004085172.1 | HigA family addiction module antitoxin | - |
| LZ757_RS08435 (LZ757_08435) | - | 1772895..1773197 (+) | 303 | WP_038230541.1 | type II toxin-antitoxin system MqsR family toxin | - |
| LZ757_RS08440 (LZ757_08440) | - | 1773200..1773601 (+) | 402 | WP_004090697.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
| LZ757_RS08445 (LZ757_08445) | - | 1773670..1774257 (-) | 588 | WP_040123117.1 | phage baseplate assembly protein V | - |
| LZ757_RS08450 (LZ757_08450) | - | 1774254..1774796 (-) | 543 | WP_038230164.1 | hypothetical protein | - |
| LZ757_RS08455 (LZ757_08455) | - | 1774772..1775293 (-) | 522 | WP_038230165.1 | hypothetical protein | - |
| LZ757_RS08460 (LZ757_08460) | - | 1775290..1775613 (-) | 324 | WP_027700441.1 | hypothetical protein | - |
| LZ757_RS08465 (LZ757_08465) | - | 1775613..1775873 (-) | 261 | WP_027700442.1 | hypothetical protein | - |
| LZ757_RS08470 (LZ757_08470) | - | 1775891..1777765 (-) | 1875 | WP_038230171.1 | phage major capsid protein | - |
| LZ757_RS08475 (LZ757_08475) | - | 1777762..1779348 (-) | 1587 | WP_040123115.1 | phage portal protein | - |
| LZ757_RS08480 (LZ757_08480) | - | 1779345..1779896 (-) | 552 | WP_038230179.1 | hypothetical protein | - |
| LZ757_RS08485 (LZ757_08485) | - | 1779900..1781852 (-) | 1953 | WP_038230181.1 | phage terminase large subunit family protein | - |
| LZ757_RS08490 (LZ757_08490) | - | 1781845..1782420 (-) | 576 | WP_004086888.1 | terminase small subunit | - |
| LZ757_RS08495 (LZ757_08495) | - | 1782551..1782775 (-) | 225 | WP_038230183.1 | hypothetical protein | - |
| LZ757_RS08500 (LZ757_08500) | - | 1782777..1783238 (-) | 462 | WP_038230185.1 | hypothetical protein | - |
| LZ757_RS08505 (LZ757_08505) | - | 1783228..1783557 (-) | 330 | WP_004086884.1 | phage holin family protein | - |
| LZ757_RS08510 (LZ757_08510) | - | 1783550..1784044 (-) | 495 | WP_234056301.1 | lysozyme | - |
| LZ757_RS08515 (LZ757_08515) | - | 1784011..1784628 (-) | 618 | WP_038230188.1 | hypothetical protein | - |
| LZ757_RS08520 (LZ757_08520) | - | 1785450..1787996 (-) | 2547 | WP_234056291.1 | phage/plasmid primase, P4 family | - |
| LZ757_RS08525 (LZ757_08525) | - | 1788133..1788699 (-) | 567 | WP_234056290.1 | Bro-N domain-containing protein | - |
| LZ757_RS08530 (LZ757_08530) | - | 1788727..1788960 (-) | 234 | WP_234056289.1 | hypothetical protein | - |
| LZ757_RS08535 (LZ757_08535) | - | 1788978..1789226 (-) | 249 | WP_004085338.1 | hypothetical protein | - |
| LZ757_RS08540 (LZ757_08540) | - | 1789223..1789411 (-) | 189 | WP_004085135.1 | hypothetical protein | - |
| LZ757_RS08545 (LZ757_08545) | - | 1789539..1789844 (+) | 306 | WP_038230427.1 | hypothetical protein | - |
| LZ757_RS08550 (LZ757_08550) | - | 1789841..1790101 (-) | 261 | WP_012382631.1 | YdaS family helix-turn-helix protein | - |
| LZ757_RS08555 (LZ757_08555) | - | 1790187..1790945 (+) | 759 | WP_038230430.1 | helix-turn-helix transcriptional regulator | - |
| LZ757_RS12335 | - | 1791620..1791967 (+) | 348 | WP_050812593.1 | hypothetical protein | - |
| LZ757_RS08565 (LZ757_08565) | - | 1791964..1792425 (+) | 462 | WP_004088545.1 | DUF1566 domain-containing protein | - |
| LZ757_RS08570 (LZ757_08570) | - | 1792425..1792826 (+) | 402 | WP_004088547.1 | hypothetical protein | - |
| LZ757_RS08575 (LZ757_08575) | - | 1792823..1793017 (+) | 195 | WP_020852641.1 | hypothetical protein | - |
| LZ757_RS08580 (LZ757_08580) | - | 1793049..1793243 (+) | 195 | WP_016024078.1 | hypothetical protein | - |
| LZ757_RS08585 (LZ757_08585) | - | 1793233..1793730 (+) | 498 | WP_234492537.1 | hypothetical protein | - |
| LZ757_RS08590 (LZ757_08590) | - | 1793727..1795007 (+) | 1281 | WP_234492538.1 | DUF2800 domain-containing protein | - |
| LZ757_RS08595 (LZ757_08595) | - | 1795004..1795570 (+) | 567 | WP_234056260.1 | DUF2815 family protein | - |
| LZ757_RS08600 (LZ757_08600) | - | 1795696..1796853 (+) | 1158 | WP_234056261.1 | BRO family protein | - |
| LZ757_RS08605 (LZ757_08605) | - | 1796855..1799035 (+) | 2181 | WP_234492539.1 | DNA polymerase | - |
| LZ757_RS08610 (LZ757_08610) | - | 1799032..1799310 (+) | 279 | WP_234056263.1 | VRR-NUC domain-containing protein | - |
| LZ757_RS08615 (LZ757_08615) | - | 1799312..1799674 (-) | 363 | WP_234056272.1 | DUF1640 domain-containing protein | - |
| LZ757_RS08620 (LZ757_08620) | - | 1799759..1801153 (+) | 1395 | WP_234056284.1 | DEAD/DEAH box helicase | - |
| LZ757_RS08625 (LZ757_08625) | - | 1801150..1801386 (+) | 237 | WP_004090683.1 | DUF4224 domain-containing protein | - |
| LZ757_RS08630 (LZ757_08630) | - | 1801398..1802459 (+) | 1062 | WP_004090681.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18227.20 Da Isoelectric Point: 5.9527
>NTDB_id=643024 LZ757_RS08340 WP_004089231.1 1756090..1756584(-) (ssb) [Xylella fastidiosa subsp. morus strain Riv19]
MARGINKVILVGNLGNDPDIKYTQGGMTITTISLATTSVRKDKDGNTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEG
SIRYDKFTGQDGQERYVTEIVADEMQMLGGRSDGGGMGGGGERPQRQTSQRQDYAPRRQTRQPSQSPQSSPPPMDDFADD
DIPF
MARGINKVILVGNLGNDPDIKYTQGGMTITTISLATTSVRKDKDGNTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEG
SIRYDKFTGQDGQERYVTEIVADEMQMLGGRSDGGGMGGGGERPQRQTSQRQDYAPRRQTRQPSQSPQSSPPPMDDFADD
DIPF
Nucleotide
Download Length: 495 bp
>NTDB_id=643024 LZ757_RS08340 WP_004089231.1 1756090..1756584(-) (ssb) [Xylella fastidiosa subsp. morus strain Riv19]
ATGGCCCGTGGTATCAATAAAGTCATCCTCGTCGGTAATCTCGGTAACGATCCGGATATCAAATACACCCAAGGTGGTAT
GACGATCACTACCATCAGCTTGGCGACAACCAGTGTTCGTAAGGACAAGGATGGCAATACCCAGGAGCGGACCGAATGGC
ACAGGGTCAAGTTTTTCGGAAAACTCGGTGAGATTGCCGGGGAATATCTACGTAAGGGATCACAGTGCTATATCGAAGGG
AGCATTCGCTATGACAAGTTCACTGGCCAGGATGGCCAAGAGCGCTATGTTACAGAGATTGTTGCTGATGAGATGCAAAT
GTTGGGTGGCCGTAGTGATGGTGGCGGTATGGGCGGGGGTGGTGAGCGCCCACAGCGTCAAACATCGCAGCGTCAGGATT
ACGCCCCACGTCGCCAGACCCGTCAGCCGTCACAGTCGCCGCAATCTTCACCGCCGCCGATGGACGATTTCGCTGATGAC
GATATTCCTTTCTAA
ATGGCCCGTGGTATCAATAAAGTCATCCTCGTCGGTAATCTCGGTAACGATCCGGATATCAAATACACCCAAGGTGGTAT
GACGATCACTACCATCAGCTTGGCGACAACCAGTGTTCGTAAGGACAAGGATGGCAATACCCAGGAGCGGACCGAATGGC
ACAGGGTCAAGTTTTTCGGAAAACTCGGTGAGATTGCCGGGGAATATCTACGTAAGGGATCACAGTGCTATATCGAAGGG
AGCATTCGCTATGACAAGTTCACTGGCCAGGATGGCCAAGAGCGCTATGTTACAGAGATTGTTGCTGATGAGATGCAAAT
GTTGGGTGGCCGTAGTGATGGTGGCGGTATGGGCGGGGGTGGTGAGCGCCCACAGCGTCAAACATCGCAGCGTCAGGATT
ACGCCCCACGTCGCCAGACCCGTCAGCCGTCACAGTCGCCGCAATCTTCACCGCCGCCGATGGACGATTTCGCTGATGAC
GATATTCCTTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
49.153 |
100 |
0.53 |
| ssb | Glaesserella parasuis strain SC1401 |
46.927 |
100 |
0.512 |
| ssb | Neisseria meningitidis MC58 |
41.618 |
100 |
0.439 |
| ssb | Neisseria gonorrhoeae MS11 |
41.04 |
100 |
0.433 |