Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   LZ757_RS08340 Genome accession   NZ_CP090506
Coordinates   1756090..1756584 (-) Length   164 a.a.
NCBI ID   WP_004089231.1    Uniprot ID   Q87DQ5
Organism   Xylella fastidiosa subsp. morus strain Riv19     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1752103..1802800 1756090..1756584 within 0


Gene organization within MGE regions


Location: 1752103..1802800
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LZ757_RS08325 (LZ757_08325) - 1752103..1753299 (-) 1197 WP_038229878.1 cation:proton antiporter -
  LZ757_RS08330 (LZ757_08330) - 1753612..1754442 (-) 831 WP_080679699.1 methyltransferase domain-containing protein -
  LZ757_RS08335 (LZ757_08335) - 1755651..1755815 (-) 165 WP_162832860.1 hypothetical protein -
  LZ757_RS08340 (LZ757_08340) ssb 1756090..1756584 (-) 495 WP_004089231.1 single-stranded DNA-binding protein Machinery gene
  LZ757_RS08345 (LZ757_08345) - 1756835..1757836 (+) 1002 WP_038229804.1 polyprenyl synthetase family protein -
  LZ757_RS08350 (LZ757_08350) cyoA 1758305..1759264 (+) 960 WP_027700012.1 ubiquinol oxidase subunit II -
  LZ757_RS08355 (LZ757_08355) cyoB 1759258..1761255 (+) 1998 WP_027700013.1 cytochrome o ubiquinol oxidase subunit I -
  LZ757_RS08360 (LZ757_08360) cyoC 1761261..1761869 (+) 609 WP_004089235.1 cytochrome o ubiquinol oxidase subunit III -
  LZ757_RS08365 (LZ757_08365) cyoD 1761869..1762210 (+) 342 WP_004089237.1 cytochrome o ubiquinol oxidase subunit IV -
  LZ757_RS08370 (LZ757_08370) - 1762506..1763588 (-) 1083 WP_234056298.1 phage late control D family protein -
  LZ757_RS08375 (LZ757_08375) - 1763579..1763797 (-) 219 WP_038230466.1 tail protein X -
  LZ757_RS08380 (LZ757_08380) - 1763794..1764276 (-) 483 WP_071869466.1 phage tail protein -
  LZ757_RS08385 (LZ757_08385) - 1764273..1766492 (-) 2220 WP_338126341.1 phage tail tape measure protein -
  LZ757_RS08390 (LZ757_08390) - 1766619..1766906 (-) 288 WP_012337638.1 phage tail assembly protein -
  LZ757_RS08395 (LZ757_08395) - 1766909..1767418 (-) 510 WP_012337639.1 phage major tail tube protein -
  LZ757_RS08400 (LZ757_08400) - 1767418..1768596 (-) 1179 WP_027700434.1 phage tail sheath family protein -
  LZ757_RS08405 (LZ757_08405) - 1768661..1770253 (-) 1593 WP_040123119.1 tail fiber domain-containing protein -
  LZ757_RS08410 (LZ757_08410) - 1770261..1770818 (-) 558 WP_027700436.1 phage tail protein I -
  LZ757_RS08415 (LZ757_08415) - 1770811..1771704 (-) 894 WP_234056296.1 baseplate J/gp47 family protein -
  LZ757_RS08420 (LZ757_08420) - 1771704..1772042 (-) 339 WP_004088650.1 GPW/gp25 family protein -
  LZ757_RS08425 (LZ757_08425) - 1772240..1772521 (+) 282 WP_004085174.1 type II toxin-antitoxin system RelE/ParE family toxin -
  LZ757_RS08430 (LZ757_08430) - 1772532..1772807 (+) 276 WP_004085172.1 HigA family addiction module antitoxin -
  LZ757_RS08435 (LZ757_08435) - 1772895..1773197 (+) 303 WP_038230541.1 type II toxin-antitoxin system MqsR family toxin -
  LZ757_RS08440 (LZ757_08440) - 1773200..1773601 (+) 402 WP_004090697.1 type II toxin-antitoxin system MqsA family antitoxin -
  LZ757_RS08445 (LZ757_08445) - 1773670..1774257 (-) 588 WP_040123117.1 phage baseplate assembly protein V -
  LZ757_RS08450 (LZ757_08450) - 1774254..1774796 (-) 543 WP_038230164.1 hypothetical protein -
  LZ757_RS08455 (LZ757_08455) - 1774772..1775293 (-) 522 WP_038230165.1 hypothetical protein -
  LZ757_RS08460 (LZ757_08460) - 1775290..1775613 (-) 324 WP_027700441.1 hypothetical protein -
  LZ757_RS08465 (LZ757_08465) - 1775613..1775873 (-) 261 WP_027700442.1 hypothetical protein -
  LZ757_RS08470 (LZ757_08470) - 1775891..1777765 (-) 1875 WP_038230171.1 phage major capsid protein -
  LZ757_RS08475 (LZ757_08475) - 1777762..1779348 (-) 1587 WP_040123115.1 phage portal protein -
  LZ757_RS08480 (LZ757_08480) - 1779345..1779896 (-) 552 WP_038230179.1 hypothetical protein -
  LZ757_RS08485 (LZ757_08485) - 1779900..1781852 (-) 1953 WP_038230181.1 phage terminase large subunit family protein -
  LZ757_RS08490 (LZ757_08490) - 1781845..1782420 (-) 576 WP_004086888.1 terminase small subunit -
  LZ757_RS08495 (LZ757_08495) - 1782551..1782775 (-) 225 WP_038230183.1 hypothetical protein -
  LZ757_RS08500 (LZ757_08500) - 1782777..1783238 (-) 462 WP_038230185.1 hypothetical protein -
  LZ757_RS08505 (LZ757_08505) - 1783228..1783557 (-) 330 WP_004086884.1 phage holin family protein -
  LZ757_RS08510 (LZ757_08510) - 1783550..1784044 (-) 495 WP_234056301.1 lysozyme -
  LZ757_RS08515 (LZ757_08515) - 1784011..1784628 (-) 618 WP_038230188.1 hypothetical protein -
  LZ757_RS08520 (LZ757_08520) - 1785450..1787996 (-) 2547 WP_234056291.1 phage/plasmid primase, P4 family -
  LZ757_RS08525 (LZ757_08525) - 1788133..1788699 (-) 567 WP_234056290.1 Bro-N domain-containing protein -
  LZ757_RS08530 (LZ757_08530) - 1788727..1788960 (-) 234 WP_234056289.1 hypothetical protein -
  LZ757_RS08535 (LZ757_08535) - 1788978..1789226 (-) 249 WP_004085338.1 hypothetical protein -
  LZ757_RS08540 (LZ757_08540) - 1789223..1789411 (-) 189 WP_004085135.1 hypothetical protein -
  LZ757_RS08545 (LZ757_08545) - 1789539..1789844 (+) 306 WP_038230427.1 hypothetical protein -
  LZ757_RS08550 (LZ757_08550) - 1789841..1790101 (-) 261 WP_012382631.1 YdaS family helix-turn-helix protein -
  LZ757_RS08555 (LZ757_08555) - 1790187..1790945 (+) 759 WP_038230430.1 helix-turn-helix transcriptional regulator -
  LZ757_RS12335 - 1791620..1791967 (+) 348 WP_050812593.1 hypothetical protein -
  LZ757_RS08565 (LZ757_08565) - 1791964..1792425 (+) 462 WP_004088545.1 DUF1566 domain-containing protein -
  LZ757_RS08570 (LZ757_08570) - 1792425..1792826 (+) 402 WP_004088547.1 hypothetical protein -
  LZ757_RS08575 (LZ757_08575) - 1792823..1793017 (+) 195 WP_020852641.1 hypothetical protein -
  LZ757_RS08580 (LZ757_08580) - 1793049..1793243 (+) 195 WP_016024078.1 hypothetical protein -
  LZ757_RS08585 (LZ757_08585) - 1793233..1793730 (+) 498 WP_234492537.1 hypothetical protein -
  LZ757_RS08590 (LZ757_08590) - 1793727..1795007 (+) 1281 WP_234492538.1 DUF2800 domain-containing protein -
  LZ757_RS08595 (LZ757_08595) - 1795004..1795570 (+) 567 WP_234056260.1 DUF2815 family protein -
  LZ757_RS08600 (LZ757_08600) - 1795696..1796853 (+) 1158 WP_234056261.1 BRO family protein -
  LZ757_RS08605 (LZ757_08605) - 1796855..1799035 (+) 2181 WP_234492539.1 DNA polymerase -
  LZ757_RS08610 (LZ757_08610) - 1799032..1799310 (+) 279 WP_234056263.1 VRR-NUC domain-containing protein -
  LZ757_RS08615 (LZ757_08615) - 1799312..1799674 (-) 363 WP_234056272.1 DUF1640 domain-containing protein -
  LZ757_RS08620 (LZ757_08620) - 1799759..1801153 (+) 1395 WP_234056284.1 DEAD/DEAH box helicase -
  LZ757_RS08625 (LZ757_08625) - 1801150..1801386 (+) 237 WP_004090683.1 DUF4224 domain-containing protein -
  LZ757_RS08630 (LZ757_08630) - 1801398..1802459 (+) 1062 WP_004090681.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 164 a.a.        Molecular weight: 18227.20 Da        Isoelectric Point: 5.9527

>NTDB_id=643024 LZ757_RS08340 WP_004089231.1 1756090..1756584(-) (ssb) [Xylella fastidiosa subsp. morus strain Riv19]
MARGINKVILVGNLGNDPDIKYTQGGMTITTISLATTSVRKDKDGNTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEG
SIRYDKFTGQDGQERYVTEIVADEMQMLGGRSDGGGMGGGGERPQRQTSQRQDYAPRRQTRQPSQSPQSSPPPMDDFADD
DIPF

Nucleotide


Download         Length: 495 bp        

>NTDB_id=643024 LZ757_RS08340 WP_004089231.1 1756090..1756584(-) (ssb) [Xylella fastidiosa subsp. morus strain Riv19]
ATGGCCCGTGGTATCAATAAAGTCATCCTCGTCGGTAATCTCGGTAACGATCCGGATATCAAATACACCCAAGGTGGTAT
GACGATCACTACCATCAGCTTGGCGACAACCAGTGTTCGTAAGGACAAGGATGGCAATACCCAGGAGCGGACCGAATGGC
ACAGGGTCAAGTTTTTCGGAAAACTCGGTGAGATTGCCGGGGAATATCTACGTAAGGGATCACAGTGCTATATCGAAGGG
AGCATTCGCTATGACAAGTTCACTGGCCAGGATGGCCAAGAGCGCTATGTTACAGAGATTGTTGCTGATGAGATGCAAAT
GTTGGGTGGCCGTAGTGATGGTGGCGGTATGGGCGGGGGTGGTGAGCGCCCACAGCGTCAAACATCGCAGCGTCAGGATT
ACGCCCCACGTCGCCAGACCCGTCAGCCGTCACAGTCGCCGCAATCTTCACCGCCGCCGATGGACGATTTCGCTGATGAC
GATATTCCTTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q87DQ5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

49.153

100

0.53

  ssb Glaesserella parasuis strain SC1401

46.927

100

0.512

  ssb Neisseria meningitidis MC58

41.618

100

0.439

  ssb Neisseria gonorrhoeae MS11

41.04

100

0.433