Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LZ755_RS08360 | Genome accession | NZ_CP090504 |
| Coordinates | 1756267..1756761 (-) | Length | 164 a.a. |
| NCBI ID | WP_004089231.1 | Uniprot ID | Q87DQ5 |
| Organism | Xylella fastidiosa subsp. morus strain Riv25 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1752280..1802985 | 1756267..1756761 | within | 0 |
Gene organization within MGE regions
Location: 1752280..1802985
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZ755_RS08345 (LZ755_08345) | - | 1752280..1753476 (-) | 1197 | WP_038229878.1 | cation:proton antiporter | - |
| LZ755_RS08350 (LZ755_08350) | - | 1753789..1754619 (-) | 831 | WP_080679699.1 | methyltransferase domain-containing protein | - |
| LZ755_RS08355 (LZ755_08355) | - | 1755828..1755992 (-) | 165 | WP_162832860.1 | hypothetical protein | - |
| LZ755_RS08360 (LZ755_08360) | ssb | 1756267..1756761 (-) | 495 | WP_004089231.1 | single-stranded DNA-binding protein | Machinery gene |
| LZ755_RS08365 (LZ755_08365) | - | 1757012..1758013 (+) | 1002 | WP_038229804.1 | polyprenyl synthetase family protein | - |
| LZ755_RS08370 (LZ755_08370) | cyoA | 1758482..1759441 (+) | 960 | WP_027700012.1 | ubiquinol oxidase subunit II | - |
| LZ755_RS08375 (LZ755_08375) | cyoB | 1759435..1761432 (+) | 1998 | WP_027700013.1 | cytochrome o ubiquinol oxidase subunit I | - |
| LZ755_RS08380 (LZ755_08380) | cyoC | 1761438..1762046 (+) | 609 | WP_004089235.1 | cytochrome o ubiquinol oxidase subunit III | - |
| LZ755_RS08385 (LZ755_08385) | cyoD | 1762046..1762387 (+) | 342 | WP_004089237.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| LZ755_RS08390 (LZ755_08390) | - | 1762683..1763765 (-) | 1083 | WP_234056298.1 | phage late control D family protein | - |
| LZ755_RS08395 (LZ755_08395) | - | 1763756..1763974 (-) | 219 | WP_038230466.1 | tail protein X | - |
| LZ755_RS08400 (LZ755_08400) | - | 1763971..1764453 (-) | 483 | WP_071869466.1 | phage tail protein | - |
| LZ755_RS08405 (LZ755_08405) | - | 1764450..1766669 (-) | 2220 | WP_338126341.1 | phage tail tape measure protein | - |
| LZ755_RS08410 (LZ755_08410) | - | 1766796..1767083 (-) | 288 | WP_012337638.1 | phage tail assembly protein | - |
| LZ755_RS08415 (LZ755_08415) | - | 1767086..1767595 (-) | 510 | WP_012337639.1 | phage major tail tube protein | - |
| LZ755_RS08420 (LZ755_08420) | - | 1767595..1768773 (-) | 1179 | WP_027700434.1 | phage tail sheath family protein | - |
| LZ755_RS08425 (LZ755_08425) | - | 1768838..1770430 (-) | 1593 | WP_040123119.1 | tail fiber domain-containing protein | - |
| LZ755_RS08430 (LZ755_08430) | - | 1770438..1770995 (-) | 558 | WP_027700436.1 | phage tail protein I | - |
| LZ755_RS08435 (LZ755_08435) | - | 1770988..1771881 (-) | 894 | WP_234056296.1 | baseplate J/gp47 family protein | - |
| LZ755_RS08440 (LZ755_08440) | - | 1771881..1772219 (-) | 339 | WP_004088650.1 | GPW/gp25 family protein | - |
| LZ755_RS08445 (LZ755_08445) | - | 1772417..1772698 (+) | 282 | WP_004085174.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LZ755_RS08450 (LZ755_08450) | - | 1772709..1772984 (+) | 276 | WP_004085172.1 | HigA family addiction module antitoxin | - |
| LZ755_RS08455 (LZ755_08455) | - | 1773072..1773374 (+) | 303 | WP_038230541.1 | type II toxin-antitoxin system MqsR family toxin | - |
| LZ755_RS08460 (LZ755_08460) | - | 1773377..1773778 (+) | 402 | WP_004090697.1 | type II toxin-antitoxin system MqsA family antitoxin | - |
| LZ755_RS08465 (LZ755_08465) | - | 1773847..1774434 (-) | 588 | WP_040123117.1 | phage baseplate assembly protein V | - |
| LZ755_RS08470 (LZ755_08470) | - | 1774431..1774973 (-) | 543 | WP_038230164.1 | hypothetical protein | - |
| LZ755_RS08475 (LZ755_08475) | - | 1774949..1775470 (-) | 522 | WP_038230165.1 | hypothetical protein | - |
| LZ755_RS08480 (LZ755_08480) | - | 1775467..1775791 (-) | 325 | Protein_1663 | hypothetical protein | - |
| LZ755_RS08485 (LZ755_08485) | - | 1775791..1776051 (-) | 261 | WP_027700442.1 | hypothetical protein | - |
| LZ755_RS08490 (LZ755_08490) | - | 1776069..1777943 (-) | 1875 | WP_038230171.1 | phage major capsid protein | - |
| LZ755_RS08495 (LZ755_08495) | - | 1777940..1779526 (-) | 1587 | WP_040123115.1 | phage portal protein | - |
| LZ755_RS08500 (LZ755_08500) | - | 1779523..1780074 (-) | 552 | WP_038230179.1 | hypothetical protein | - |
| LZ755_RS08505 (LZ755_08505) | - | 1780078..1781709 (-) | 1632 | WP_234553083.1 | terminase gpA endonuclease subunit | - |
| LZ755_RS08510 (LZ755_08510) | - | 1781706..1782029 (-) | 324 | WP_234553084.1 | phage terminase large subunit family protein | - |
| LZ755_RS08515 (LZ755_08515) | - | 1782022..1782597 (-) | 576 | WP_004086888.1 | terminase small subunit | - |
| LZ755_RS08520 (LZ755_08520) | - | 1782728..1782952 (-) | 225 | WP_038230183.1 | hypothetical protein | - |
| LZ755_RS08525 (LZ755_08525) | - | 1782954..1783415 (-) | 462 | WP_038230185.1 | hypothetical protein | - |
| LZ755_RS08530 (LZ755_08530) | - | 1783405..1783734 (-) | 330 | WP_004086884.1 | phage holin family protein | - |
| LZ755_RS08535 (LZ755_08535) | - | 1783727..1784221 (-) | 495 | WP_234056301.1 | lysozyme | - |
| LZ755_RS08540 (LZ755_08540) | - | 1784188..1784805 (-) | 618 | WP_038230188.1 | hypothetical protein | - |
| LZ755_RS08545 (LZ755_08545) | - | 1785634..1788180 (-) | 2547 | WP_234056291.1 | phage/plasmid primase, P4 family | - |
| LZ755_RS08550 (LZ755_08550) | - | 1788317..1788883 (-) | 567 | WP_234056290.1 | Bro-N domain-containing protein | - |
| LZ755_RS08555 (LZ755_08555) | - | 1788911..1789144 (-) | 234 | WP_234056289.1 | hypothetical protein | - |
| LZ755_RS08560 (LZ755_08560) | - | 1789162..1789410 (-) | 249 | WP_004085338.1 | hypothetical protein | - |
| LZ755_RS08565 (LZ755_08565) | - | 1789407..1789595 (-) | 189 | WP_004085135.1 | hypothetical protein | - |
| LZ755_RS08570 (LZ755_08570) | - | 1789723..1790028 (+) | 306 | WP_038230427.1 | hypothetical protein | - |
| LZ755_RS08575 (LZ755_08575) | - | 1790025..1790285 (-) | 261 | WP_012382631.1 | YdaS family helix-turn-helix protein | - |
| LZ755_RS08580 (LZ755_08580) | - | 1790371..1791129 (+) | 759 | WP_038230430.1 | helix-turn-helix transcriptional regulator | - |
| LZ755_RS12375 | - | 1791804..1792151 (+) | 348 | WP_050812593.1 | hypothetical protein | - |
| LZ755_RS08590 (LZ755_08590) | - | 1792148..1792609 (+) | 462 | WP_004088545.1 | DUF1566 domain-containing protein | - |
| LZ755_RS08595 (LZ755_08595) | - | 1792609..1793010 (+) | 402 | WP_004088547.1 | hypothetical protein | - |
| LZ755_RS08600 (LZ755_08600) | - | 1793007..1793201 (+) | 195 | WP_020852641.1 | hypothetical protein | - |
| LZ755_RS08605 (LZ755_08605) | - | 1793233..1793427 (+) | 195 | WP_016024078.1 | hypothetical protein | - |
| LZ755_RS08610 (LZ755_08610) | - | 1793427..1793915 (+) | 489 | WP_338126343.1 | hypothetical protein | - |
| LZ755_RS08615 (LZ755_08615) | - | 1793912..1795192 (+) | 1281 | WP_234492538.1 | DUF2800 domain-containing protein | - |
| LZ755_RS08620 (LZ755_08620) | - | 1795189..1795755 (+) | 567 | WP_234056260.1 | DUF2815 family protein | - |
| LZ755_RS08625 (LZ755_08625) | - | 1795881..1797038 (+) | 1158 | WP_234056261.1 | BRO family protein | - |
| LZ755_RS08630 (LZ755_08630) | - | 1797040..1799220 (+) | 2181 | WP_234492539.1 | DNA polymerase | - |
| LZ755_RS08635 (LZ755_08635) | - | 1799217..1799495 (+) | 279 | WP_234056263.1 | VRR-NUC domain-containing protein | - |
| LZ755_RS08640 (LZ755_08640) | - | 1799497..1799859 (-) | 363 | WP_234056272.1 | DUF1640 domain-containing protein | - |
| LZ755_RS08645 (LZ755_08645) | - | 1799944..1801338 (+) | 1395 | WP_234056284.1 | DEAD/DEAH box helicase | - |
| LZ755_RS08650 (LZ755_08650) | - | 1801335..1801571 (+) | 237 | WP_004090683.1 | DUF4224 domain-containing protein | - |
| LZ755_RS08655 (LZ755_08655) | - | 1801583..1802644 (+) | 1062 | WP_004090681.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 164 a.a. Molecular weight: 18227.20 Da Isoelectric Point: 5.9527
>NTDB_id=643007 LZ755_RS08360 WP_004089231.1 1756267..1756761(-) (ssb) [Xylella fastidiosa subsp. morus strain Riv25]
MARGINKVILVGNLGNDPDIKYTQGGMTITTISLATTSVRKDKDGNTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEG
SIRYDKFTGQDGQERYVTEIVADEMQMLGGRSDGGGMGGGGERPQRQTSQRQDYAPRRQTRQPSQSPQSSPPPMDDFADD
DIPF
MARGINKVILVGNLGNDPDIKYTQGGMTITTISLATTSVRKDKDGNTQERTEWHRVKFFGKLGEIAGEYLRKGSQCYIEG
SIRYDKFTGQDGQERYVTEIVADEMQMLGGRSDGGGMGGGGERPQRQTSQRQDYAPRRQTRQPSQSPQSSPPPMDDFADD
DIPF
Nucleotide
Download Length: 495 bp
>NTDB_id=643007 LZ755_RS08360 WP_004089231.1 1756267..1756761(-) (ssb) [Xylella fastidiosa subsp. morus strain Riv25]
ATGGCCCGTGGTATCAATAAAGTCATCCTCGTCGGTAATCTCGGTAACGATCCGGATATCAAATACACCCAAGGTGGTAT
GACGATCACTACCATCAGCTTGGCGACAACCAGTGTTCGTAAGGACAAGGATGGCAATACCCAGGAGCGGACCGAATGGC
ACAGGGTCAAGTTTTTCGGAAAACTCGGTGAGATTGCCGGGGAATATCTACGTAAGGGATCACAGTGCTATATCGAAGGG
AGCATTCGCTATGACAAGTTCACTGGCCAGGATGGCCAAGAGCGCTATGTTACAGAGATTGTTGCTGATGAGATGCAAAT
GTTGGGTGGCCGTAGTGATGGTGGCGGTATGGGCGGGGGTGGTGAGCGCCCACAGCGTCAAACATCGCAGCGTCAGGATT
ACGCCCCACGTCGCCAGACCCGTCAGCCGTCACAGTCGCCGCAATCTTCACCGCCGCCGATGGACGATTTCGCTGATGAC
GATATTCCTTTCTAA
ATGGCCCGTGGTATCAATAAAGTCATCCTCGTCGGTAATCTCGGTAACGATCCGGATATCAAATACACCCAAGGTGGTAT
GACGATCACTACCATCAGCTTGGCGACAACCAGTGTTCGTAAGGACAAGGATGGCAATACCCAGGAGCGGACCGAATGGC
ACAGGGTCAAGTTTTTCGGAAAACTCGGTGAGATTGCCGGGGAATATCTACGTAAGGGATCACAGTGCTATATCGAAGGG
AGCATTCGCTATGACAAGTTCACTGGCCAGGATGGCCAAGAGCGCTATGTTACAGAGATTGTTGCTGATGAGATGCAAAT
GTTGGGTGGCCGTAGTGATGGTGGCGGTATGGGCGGGGGTGGTGAGCGCCCACAGCGTCAAACATCGCAGCGTCAGGATT
ACGCCCCACGTCGCCAGACCCGTCAGCCGTCACAGTCGCCGCAATCTTCACCGCCGCCGATGGACGATTTCGCTGATGAC
GATATTCCTTTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
49.153 |
100 |
0.53 |
| ssb | Glaesserella parasuis strain SC1401 |
46.927 |
100 |
0.512 |
| ssb | Neisseria meningitidis MC58 |
41.618 |
100 |
0.439 |
| ssb | Neisseria gonorrhoeae MS11 |
41.04 |
100 |
0.433 |