Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LU631_RS23895 Genome accession   NZ_CP089940
Coordinates   4586046..4586606 (-) Length   186 a.a.
NCBI ID   WP_016190697.1    Uniprot ID   A0A0M2KBM0
Organism   Erwinia tracheiphila strain BuffGH     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 4539702..4600487 4586046..4586606 within 0
IS/Tn 4584107..4585429 4586046..4586606 flank 617


Gene organization within MGE regions


Location: 4539702..4600487
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LU631_RS23655 (LU631_23655) - 4539702..4540712 (-) 1011 WP_016190741.1 tyrosine-type recombinase/integrase -
  LU631_RS23660 (LU631_23660) - 4540773..4542362 (-) 1590 WP_016190740.1 conjugal transfer nickase/helicase domain-containing protein -
  LU631_RS23665 (LU631_23665) - 4542356..4543840 (-) 1485 WP_016190739.1 UvrD-helicase domain-containing protein -
  LU631_RS23670 (LU631_23670) - 4544023..4544322 (+) 300 WP_016190738.1 hypothetical protein -
  LU631_RS23675 (LU631_23675) - 4544466..4544870 (+) 405 WP_071598904.1 hypothetical protein -
  LU631_RS23680 (LU631_23680) - 4545080..4546288 (+) 1209 WP_046371917.1 IS256 family transposase -
  LU631_RS23685 (LU631_23685) - 4546393..4547088 (-) 696 WP_016190736.1 hypothetical protein -
  LU631_RS23690 (LU631_23690) - 4547262..4547945 (-) 684 WP_040465530.1 N-6 DNA methylase -
  LU631_RS23695 (LU631_23695) - 4548062..4548997 (-) 936 WP_016190734.1 DUF1281 domain-containing protein -
  LU631_RS23700 (LU631_23700) - 4549105..4550163 (-) 1059 WP_016190733.1 ArdC family protein -
  LU631_RS23705 (LU631_23705) - 4550236..4550850 (-) 615 WP_040465529.1 hypothetical protein -
  LU631_RS23710 (LU631_23710) - 4550958..4551956 (-) 999 WP_016190732.1 hypothetical protein -
  LU631_RS23715 (LU631_23715) - 4552094..4552432 (-) 339 WP_016190731.1 hypothetical protein -
  LU631_RS23720 (LU631_23720) - 4552840..4553262 (-) 423 WP_015869809.1 hypothetical protein -
  LU631_RS23725 (LU631_23725) - 4553283..4554206 (-) 924 WP_016190730.1 integrase domain-containing protein -
  LU631_RS23730 (LU631_23730) - 4555227..4555928 (-) 702 WP_016190729.1 YkgJ family cysteine cluster protein -
  LU631_RS23735 (LU631_23735) - 4556119..4556622 (-) 504 WP_016190728.1 hypothetical protein -
  LU631_RS23740 (LU631_23740) - 4556770..4556949 (+) 180 WP_016190727.1 hypothetical protein -
  LU631_RS23745 (LU631_23745) - 4556984..4558525 (-) 1542 WP_016190726.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  LU631_RS23750 (LU631_23750) - 4558532..4558885 (-) 354 WP_040465557.1 hypothetical protein -
  LU631_RS23755 (LU631_23755) - 4558899..4560332 (-) 1434 WP_016190724.1 integrating conjugative element protein -
  LU631_RS23760 (LU631_23760) - 4560344..4561336 (-) 993 WP_016190723.1 TIGR03756 family integrating conjugative element protein -
  LU631_RS23765 (LU631_23765) - 4561333..4561734 (-) 402 WP_016190722.1 TIGR03757 family integrating conjugative element protein -
  LU631_RS23770 (LU631_23770) - 4562053..4565853 (-) 3801 WP_016190721.1 DNA-binding protein -
  LU631_RS23775 (LU631_23775) - 4565981..4566364 (-) 384 WP_016190720.1 hypothetical protein -
  LU631_RS23780 (LU631_23780) - 4566361..4569180 (-) 2820 WP_232426862.1 conjugative transfer ATPase -
  LU631_RS23785 (LU631_23785) - 4569225..4569638 (-) 414 WP_016190718.1 TIGR03751 family conjugal transfer lipoprotein -
  LU631_RS23790 (LU631_23790) - 4569650..4571155 (-) 1506 WP_016190717.1 TIGR03752 family integrating conjugative element protein -
  LU631_RS23795 (LU631_23795) - 4571145..4572068 (-) 924 WP_016190716.1 TIGR03749 family integrating conjugative element protein -
  LU631_RS23800 (LU631_23800) - 4572068..4572727 (-) 660 WP_016190715.1 PFL_4703 family integrating conjugative element protein -
  LU631_RS23805 (LU631_23805) - 4572724..4573080 (-) 357 WP_016190714.1 TIGR03750 family conjugal transfer protein -
  LU631_RS23810 (LU631_23810) - 4573090..4573476 (-) 387 WP_016190713.1 TIGR03745 family integrating conjugative element membrane protein -
  LU631_RS23815 (LU631_23815) - 4573507..4573749 (-) 243 WP_016190712.1 TIGR03758 family integrating conjugative element protein -
  LU631_RS23820 (LU631_23820) - 4573749..4574090 (-) 342 WP_016190711.1 RAQPRD family integrative conjugative element protein -
  LU631_RS23825 (LU631_23825) - 4574428..4575567 (+) 1140 WP_016190710.1 DNA cytosine methyltransferase -
  LU631_RS23830 (LU631_23830) - 4575560..4576552 (+) 993 WP_016190709.1 DUF4928 family protein -
  LU631_RS23835 (LU631_23835) - 4576854..4577612 (-) 759 WP_016190708.1 TIGR03747 family integrating conjugative element membrane protein -
  LU631_RS23840 (LU631_23840) traD 4577605..4579695 (-) 2091 WP_016190707.1 type IV conjugative transfer system coupling protein TraD -
  LU631_RS23845 (LU631_23845) - 4579688..4580200 (-) 513 WP_016190706.1 hypothetical protein -
  LU631_RS23850 (LU631_23850) - 4580197..4580796 (-) 600 WP_016190705.1 restriction endonuclease -
  LU631_RS23855 (LU631_23855) - 4580796..4581308 (-) 513 WP_016190704.1 integrating conjugative element protein -
  LU631_RS23860 (LU631_23860) - 4581308..4581982 (-) 675 WP_016190703.1 transglycosylase SLT domain-containing protein -
  LU631_RS23865 (LU631_23865) - 4581961..4582665 (-) 705 WP_016190702.1 TIGR03759 family integrating conjugative element protein -
  LU631_RS23870 (LU631_23870) - 4582672..4583394 (-) 723 WP_016190701.1 hypothetical protein -
  LU631_RS23875 (LU631_23875) - 4583391..4583987 (-) 597 WP_016190700.1 PilL N-terminal domain-containing protein -
  LU631_RS23880 (LU631_23880) - 4584107..4585429 (-) 1323 WP_046371900.1 IS4 family transposase -
  LU631_RS23885 (LU631_23885) - 4585552..4585815 (-) 264 WP_016190699.1 DUF2442 domain-containing protein -
  LU631_RS23890 (LU631_23890) - 4585796..4586032 (-) 237 WP_016190698.1 DUF4160 domain-containing protein -
  LU631_RS23895 (LU631_23895) ssb 4586046..4586606 (-) 561 WP_016190697.1 single-stranded DNA-binding protein Machinery gene
  LU631_RS23900 (LU631_23900) - 4586619..4586822 (-) 204 WP_016190696.1 hypothetical protein -
  LU631_RS23905 (LU631_23905) - 4586900..4587364 (-) 465 WP_016190695.1 STY4534 family ICE replication protein -
  LU631_RS23910 (LU631_23910) - 4588014..4590044 (-) 2031 WP_016190694.1 DNA topoisomerase III -
  LU631_RS23915 (LU631_23915) - 4590060..4590815 (-) 756 WP_016190693.1 PFL_4669 family integrating conjugative element protein -
  LU631_RS23920 (LU631_23920) - 4591097..4592353 (-) 1257 WP_016190692.1 STY4528 family pathogenicity island replication protein -
  LU631_RS23925 (LU631_23925) - 4592444..4592692 (-) 249 WP_016190691.1 hypothetical protein -
  LU631_RS23930 (LU631_23930) - 4592689..4593291 (-) 603 WP_016190690.1 DUF2857 domain-containing protein -
  LU631_RS23935 (LU631_23935) - 4593288..4594097 (-) 810 WP_016190689.1 DNA adenine methylase -
  LU631_RS23940 (LU631_23940) - 4594081..4595766 (-) 1686 WP_016190688.1 ParB family protein -
  LU631_RS23945 (LU631_23945) dnaB-PI 4595763..4597133 (-) 1371 WP_016190687.1 SPI-7-type island replicative DNA helicase -
  LU631_RS23950 (LU631_23950) - 4597345..4597746 (+) 402 WP_052734713.1 hypothetical protein -
  LU631_RS23955 (LU631_23955) - 4597920..4598300 (-) 381 WP_016190685.1 hypothetical protein -
  LU631_RS23960 (LU631_23960) - 4598297..4599169 (-) 873 WP_016190684.1 ParA family protein -
  LU631_RS23965 (LU631_23965) - 4599474..4600487 (-) 1014 WP_016190683.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 186 a.a.        Molecular weight: 20351.56 Da        Isoelectric Point: 6.8714

>NTDB_id=639282 LU631_RS23895 WP_016190697.1 4586046..4586606(-) (ssb) [Erwinia tracheiphila strain BuffGH]
MASRGINKVILVGNLGQDPEVRYMPNSNAVTTLSIATSESWRDKQTGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWQDQHGQDRYSTEVVVNVNGSMQMLGSRQHSGSSSSQYQGSQQQGWGQPQQPVSGGQPSQVGPSSTGSSAAG
MPMDFDDDIPFIGCGYGVNRVTIHAI

Nucleotide


Download         Length: 561 bp        

>NTDB_id=639282 LU631_RS23895 WP_016190697.1 4586046..4586606(-) (ssb) [Erwinia tracheiphila strain BuffGH]
ATGGCTTCACGTGGAATTAACAAAGTCATTCTGGTTGGAAATTTAGGCCAGGATCCTGAAGTGCGCTATATGCCCAACAG
TAACGCAGTGACCACGCTGTCGATCGCGACTTCAGAGAGCTGGCGCGATAAGCAAACCGGCGAAATGAAAGAGCAGACCG
AATGGCACCGTGTTGTGCTGTTCGGCAAACTGGCGGAAGTGGCCAGTGAATATCTGCGTAAAGGCTCACAGGTGTATATT
GAAGGCCAGTTACGTACCCGTAAATGGCAGGATCAGCATGGCCAGGATCGTTATTCTACCGAAGTGGTGGTCAACGTGAA
CGGTAGCATGCAGATGCTGGGGAGTCGTCAGCACTCGGGCAGCTCCTCCTCTCAATACCAGGGCTCTCAACAGCAGGGAT
GGGGGCAACCTCAGCAGCCTGTATCAGGTGGTCAGCCGTCTCAGGTTGGGCCATCGTCAACCGGAAGCTCTGCTGCCGGC
ATGCCGATGGATTTTGACGACGACATCCCCTTTATCGGGTGTGGTTATGGCGTTAATCGCGTGACCATACACGCAATATG
A

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(6-112)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A0M2KBM0

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.232

95.161

0.64
  ssb Glaesserella parasuis strain SC1401

52.973

99.462

0.527
  ssb Neisseria meningitidis MC58

42.614

94.624

0.403
  ssb Neisseria gonorrhoeae MS11

42.614

94.624

0.403