Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LUU82_RS13860 | Genome accession | NZ_CP089586 |
| Coordinates | 2776753..2777223 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934761.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain E1185_IV_ST12 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2765328..2782383 | 2776753..2777223 | within | 0 |
Gene organization within MGE regions
Location: 2765328..2782383
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUU82_RS13755 (LUU82_13755) | - | 2765328..2766365 (-) | 1038 | WP_000857191.1 | tyrosine-type recombinase/integrase | - |
| LUU82_RS13760 (LUU82_13760) | - | 2766424..2766888 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| LUU82_RS13765 (LUU82_13765) | - | 2766988..2767170 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| LUU82_RS13770 (LUU82_13770) | - | 2767374..2767715 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| LUU82_RS13775 (LUU82_13775) | - | 2767721..2768653 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| LUU82_RS13780 (LUU82_13780) | - | 2768669..2769382 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| LUU82_RS13785 (LUU82_13785) | - | 2769345..2769518 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| LUU82_RS13790 (LUU82_13790) | - | 2769515..2769778 (+) | 264 | WP_000854070.1 | helix-turn-helix transcriptional regulator | - |
| LUU82_RS13795 (LUU82_13795) | - | 2769794..2770009 (+) | 216 | WP_001025404.1 | Thoeris anti-defense Tad2 family protein | - |
| LUU82_RS13800 (LUU82_13800) | - | 2769998..2770327 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| LUU82_RS13805 (LUU82_13805) | - | 2770378..2771130 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| LUU82_RS13810 (LUU82_13810) | - | 2771146..2771343 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| LUU82_RS13815 (LUU82_13815) | - | 2771330..2771710 (-) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| LUU82_RS13820 (LUU82_13820) | - | 2771765..2772088 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| LUU82_RS13825 (LUU82_13825) | - | 2772085..2772246 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| LUU82_RS13830 (LUU82_13830) | - | 2772341..2772643 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| LUU82_RS13835 (LUU82_13835) | - | 2772648..2772908 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| LUU82_RS13840 (LUU82_13840) | - | 2772917..2773180 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LUU82_RS13845 (LUU82_13845) | - | 2773189..2775132 (+) | 1944 | WP_000700568.1 | AAA family ATPase | - |
| LUU82_RS13850 (LUU82_13850) | - | 2775134..2776054 (+) | 921 | WP_103246325.1 | recombinase RecT | - |
| LUU82_RS13855 (LUU82_13855) | - | 2776135..2776752 (+) | 618 | WP_078072714.1 | MBL fold metallo-hydrolase | - |
| LUU82_RS13860 (LUU82_13860) | ssbA | 2776753..2777223 (+) | 471 | WP_000934761.1 | single-stranded DNA-binding protein | Machinery gene |
| LUU82_RS13865 (LUU82_13865) | - | 2777253..2778137 (+) | 885 | WP_000148300.1 | DnaD domain protein | - |
| LUU82_RS13870 (LUU82_13870) | - | 2778144..2778362 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| LUU82_RS13875 (LUU82_13875) | - | 2778371..2778775 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LUU82_RS13880 (LUU82_13880) | - | 2778788..2779156 (+) | 369 | WP_000101286.1 | SA1788 family PVL leukocidin-associated protein | - |
| LUU82_RS13885 (LUU82_13885) | - | 2779160..2779402 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| LUU82_RS13890 (LUU82_13890) | - | 2779417..2779665 (+) | 249 | WP_001065094.1 | DUF1024 family protein | - |
| LUU82_RS13895 (LUU82_13895) | - | 2779658..2780194 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| LUU82_RS13900 (LUU82_13900) | - | 2780231..2780476 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| LUU82_RS13905 (LUU82_13905) | - | 2780473..2780679 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| LUU82_RS13910 (LUU82_13910) | - | 2780676..2781062 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| LUU82_RS13915 (LUU82_13915) | rinB | 2781059..2781208 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LUU82_RS13920 (LUU82_13920) | - | 2781208..2781408 (+) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| LUU82_RS13925 (LUU82_13925) | - | 2781436..2781852 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| LUU82_RS13930 (LUU82_13930) | - | 2782084..2782383 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17683.60 Da Isoelectric Point: 5.2672
>NTDB_id=638164 LUU82_RS13860 WP_000934761.1 2776753..2777223(+) (ssbA) [Staphylococcus aureus strain E1185_IV_ST12]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=638164 LUU82_RS13860 WP_000934761.1 2776753..2777223(+) (ssbA) [Staphylococcus aureus strain E1185_IV_ST12]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |