Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LUY96_RS09160 | Genome accession | NZ_CP089502 |
| Coordinates | 1783490..1783993 (-) | Length | 167 a.a. |
| NCBI ID | WP_000934799.1 | Uniprot ID | A0A7U7IE99 |
| Organism | Staphylococcus aureus strain 3488_VV_ ST8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1762319..1788056 | 1783490..1783993 | within | 0 |
Gene organization within MGE regions
Location: 1762319..1788056
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUY96_RS08995 | - | 1762319..1762570 (-) | 252 | WP_000466748.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| LUY96_RS09000 | - | 1762870..1763133 (+) | 264 | WP_001055897.1 | helix-turn-helix transcriptional regulator | - |
| LUY96_RS09005 | - | 1763271..1763843 (-) | 573 | WP_000769720.1 | PepSY domain-containing protein | - |
| LUY96_RS09010 | - | 1764024..1764392 (-) | 369 | WP_000849177.1 | YxeA family protein | - |
| LUY96_RS09015 | selX | 1764761..1765372 (-) | 612 | WP_000475326.1 | staphylococcal enterotoxin-like toxin X | - |
| LUY96_RS09020 | - | 1765578..1766279 (+) | 702 | Protein_1733 | tyrosine-type recombinase/integrase | - |
| LUY96_RS09025 | - | 1766318..1767256 (+) | 939 | WP_001822249.1 | Abi family protein | - |
| LUY96_RS09030 | - | 1767860..1768039 (-) | 180 | WP_000797954.1 | hypothetical protein | - |
| LUY96_RS09035 | - | 1768055..1768567 (-) | 513 | WP_000813311.1 | hypothetical protein | - |
| LUY96_RS09040 | - | 1768685..1768966 (-) | 282 | WP_001577971.1 | hypothetical protein | - |
| LUY96_RS09045 | - | 1769312..1769704 (-) | 393 | WP_017431599.1 | hypothetical protein | - |
| LUY96_RS09050 | - | 1770078..1770506 (-) | 429 | WP_000591858.1 | hypothetical protein | - |
| LUY96_RS09055 | - | 1770503..1771021 (-) | 519 | WP_000624990.1 | hypothetical protein | - |
| LUY96_RS09060 | - | 1771450..1772019 (-) | 570 | WP_001281787.1 | terminase small subunit | - |
| LUY96_RS09065 | - | 1772016..1772228 (-) | 213 | WP_025174984.1 | hypothetical protein | - |
| LUY96_RS09070 | - | 1772360..1772887 (-) | 528 | WP_048667706.1 | spore coat protein | - |
| LUY96_RS09075 | - | 1772940..1773593 (-) | 654 | WP_048667708.1 | hypothetical protein | - |
| LUY96_RS09080 | - | 1773624..1773965 (-) | 342 | WP_001190614.1 | hypothetical protein | - |
| LUY96_RS09085 | - | 1774501..1775142 (-) | 642 | WP_061732984.1 | pathogenicity island protein | - |
| LUY96_RS09090 | - | 1775139..1775423 (-) | 285 | WP_000998181.1 | hypothetical protein | - |
| LUY96_RS09095 | - | 1775425..1775787 (-) | 363 | WP_001039168.1 | hypothetical protein | - |
| LUY96_RS09100 | - | 1776088..1777545 (-) | 1458 | WP_000390455.1 | virulence-associated E family protein | - |
| LUY96_RS09105 | - | 1777562..1778431 (-) | 870 | WP_061642140.1 | primase alpha helix C-terminal domain-containing protein | - |
| LUY96_RS09110 | tscT | 1778495..1778821 (-) | 327 | WP_061731591.1 | type II toxin-antitoxin system toxin TscT | - |
| LUY96_RS09115 | - | 1778822..1779205 (-) | 384 | WP_031788845.1 | hypothetical protein | - |
| LUY96_RS09120 | - | 1779207..1779410 (-) | 204 | Protein_1753 | pathogenicity island protein | - |
| LUY96_RS09125 | - | 1779377..1779550 (-) | 174 | WP_000784892.1 | hypothetical protein | - |
| LUY96_RS09130 | - | 1779562..1779834 (-) | 273 | WP_001138305.1 | helix-turn-helix domain-containing protein | - |
| LUY96_RS09135 | - | 1779835..1779999 (-) | 165 | WP_001611932.1 | helix-turn-helix domain-containing protein | - |
| LUY96_RS09140 | - | 1780148..1780771 (+) | 624 | WP_000230361.1 | helix-turn-helix transcriptional regulator | - |
| LUY96_RS09145 | - | 1780932..1782146 (+) | 1215 | WP_015977853.1 | site-specific integrase | - |
| LUY96_RS09150 | - | 1782170..1782967 (+) | 798 | WP_000119675.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LUY96_RS09155 | rpsR | 1783196..1783438 (-) | 243 | WP_000897044.1 | 30S ribosomal protein S18 | - |
| LUY96_RS09160 | ssbA | 1783490..1783993 (-) | 504 | WP_000934799.1 | single-stranded DNA-binding protein | Machinery gene |
| LUY96_RS09165 | rpsF | 1784014..1784310 (-) | 297 | WP_001261460.1 | 30S ribosomal protein S6 | - |
| LUY96_RS09170 | - | 1784554..1784745 (+) | 192 | WP_001052483.1 | hypothetical protein | - |
| LUY96_RS09175 | ychF | 1784831..1785928 (-) | 1098 | WP_001218732.1 | redox-regulated ATPase YchF | - |
| LUY96_RS09180 | - | 1785940..1786143 (-) | 204 | WP_000157345.1 | DUF951 domain-containing protein | - |
| LUY96_RS09185 | - | 1786173..1787054 (-) | 882 | WP_001077602.1 | mechanosensitive ion channel family protein | - |
| LUY96_RS09190 | - | 1787211..1788056 (-) | 846 | WP_001550052.1 | ParB/RepB/Spo0J family partition protein | - |
Sequence
Protein
Download Length: 167 a.a. Molecular weight: 18539.12 Da Isoelectric Point: 4.7305
>NTDB_id=637705 LUY96_RS09160 WP_000934799.1 1783490..1783993(-) (ssbA) [Staphylococcus aureus strain 3488_VV_ ST8]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDI
SDDDLPF
Nucleotide
Download Length: 504 bp
>NTDB_id=637705 LUY96_RS09160 WP_000934799.1 1783490..1783993(-) (ssbA) [Staphylococcus aureus strain 3488_VV_ ST8]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCCTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTCCTTGAACCTAAAAA
TGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTCCAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAACAATTCGTACAATAATTCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
AGTGATGATGACTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.341 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.971 |
100 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
63.473 |
0.371 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.365 |