Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   LUY93_RS09420 Genome accession   NZ_CP089500
Coordinates   1839668..1840138 (-) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 3144_IIV_ST8     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1809550..1857346 1839668..1840138 within 0


Gene organization within MGE regions


Location: 1809550..1857346
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUY93_RS09210 scn 1809550..1809900 (-) 351 WP_000702262.1 complement inhibitor SCIN-A -
  LUY93_RS09215 - 1810410..1810748 (-) 339 Protein_1784 SH3 domain-containing protein -
  LUY93_RS09220 sak 1811397..1811888 (-) 492 WP_000920041.1 staphylokinase -
  LUY93_RS09225 - 1812079..1812834 (-) 756 WP_000861038.1 CHAP domain-containing protein -
  LUY93_RS09230 - 1812846..1813100 (-) 255 WP_000611512.1 phage holin -
  LUY93_RS09235 - 1813152..1813259 (+) 108 Protein_1788 hypothetical protein -
  LUY93_RS09240 pepG1 1813312..1813446 (-) 135 WP_000226106.1 type I toxin-antitoxin system toxin PepG1 -
  LUY93_RS09245 sea 1813597..1814370 (-) 774 WP_000750412.1 staphylococcal enterotoxin type A -
  LUY93_RS09250 - 1814743..1815117 (-) 375 WP_000340977.1 hypothetical protein -
  LUY93_RS09255 - 1815173..1815459 (-) 287 Protein_1792 hypothetical protein -
  LUY93_RS09260 - 1815505..1815657 (-) 153 WP_001000059.1 hypothetical protein -
  LUY93_RS09265 - 1815650..1819432 (-) 3783 WP_000582173.1 phage tail spike protein -
  LUY93_RS09270 - 1819448..1820932 (-) 1485 WP_000567408.1 phage distal tail protein -
  LUY93_RS09275 - 1820929..1825458 (-) 4530 WP_001795393.1 phage tail tape measure protein -
  LUY93_RS09280 gpGT 1825515..1825652 (-) 138 WP_001549167.1 phage tail assembly chaperone GT -
  LUY93_RS09285 gpG 1825703..1826053 (-) 351 WP_001096355.1 phage tail assembly chaperone G -
  LUY93_RS09290 - 1826103..1826327 (-) 225 WP_072050172.1 Ig-like domain-containing protein -
  LUY93_RS09295 - 1826369..1827013 (-) 645 WP_000268741.1 major tail protein -
  LUY93_RS09300 - 1827014..1827421 (-) 408 WP_000565498.1 hypothetical protein -
  LUY93_RS09305 - 1827418..1827822 (-) 405 WP_000114225.1 HK97 gp10 family phage protein -
  LUY93_RS09310 - 1827819..1828181 (-) 363 WP_000755150.1 head-tail adaptor protein -
  LUY93_RS09315 - 1828165..1828449 (-) 285 WP_000150936.1 phage head-tail adapter protein -
  LUY93_RS09320 - 1828439..1828723 (-) 285 WP_000238236.1 hypothetical protein -
  LUY93_RS09325 - 1828743..1829888 (-) 1146 WP_000154555.1 phage major capsid protein -
  LUY93_RS09330 - 1829912..1830649 (-) 738 WP_000861914.1 head maturation protease, ClpP-related -
  LUY93_RS09335 - 1830633..1831820 (-) 1188 WP_000025274.1 phage portal protein -
  LUY93_RS09340 - 1831836..1833497 (-) 1662 WP_000625088.1 terminase large subunit -
  LUY93_RS09345 - 1833494..1833838 (-) 345 WP_000402904.1 hypothetical protein -
  LUY93_RS09350 - 1833969..1834268 (-) 300 WP_000988336.1 HNH endonuclease -
  LUY93_RS09355 - 1834500..1834916 (-) 417 WP_000590126.1 hypothetical protein -
  LUY93_RS09360 - 1834944..1835144 (-) 201 WP_000265039.1 DUF1514 family protein -
  LUY93_RS09365 rinB 1835144..1835293 (-) 150 WP_000595265.1 transcriptional activator RinB -
  LUY93_RS09370 - 1835290..1835496 (-) 207 WP_000195820.1 DUF1381 domain-containing protein -
  LUY93_RS09375 - 1835533..1836069 (-) 537 WP_001066444.1 dUTPase -
  LUY93_RS09380 - 1836062..1836472 (-) 411 WP_000197967.1 hypothetical protein -
  LUY93_RS09385 - 1836469..1836978 (-) 510 WP_001105598.1 hypothetical protein -
  LUY93_RS09390 - 1836975..1837424 (-) 450 WP_000982711.1 YopX family protein -
  LUY93_RS09395 - 1837489..1837731 (-) 243 WP_000131366.1 SAV1978 family virulence-associated passenger protein -
  LUY93_RS09400 - 1837735..1838103 (-) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  LUY93_RS09405 - 1838116..1838520 (-) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  LUY93_RS09410 - 1838529..1838747 (-) 219 WP_000338528.1 hypothetical protein -
  LUY93_RS09415 - 1838754..1839638 (-) 885 WP_000148301.1 DnaD domain protein -
  LUY93_RS09420 ssbA 1839668..1840138 (-) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  LUY93_RS09425 - 1840139..1840756 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  LUY93_RS09430 - 1840837..1841757 (-) 921 WP_407545430.1 recombinase RecT -
  LUY93_RS09435 - 1841759..1843702 (-) 1944 WP_000700565.1 AAA family ATPase -
  LUY93_RS09440 - 1843711..1843974 (-) 264 WP_001205732.1 hypothetical protein -
  LUY93_RS09445 - 1843983..1844243 (-) 261 WP_000291489.1 DUF1108 family protein -
  LUY93_RS09450 - 1844336..1844497 (-) 162 WP_000066020.1 DUF1270 domain-containing protein -
  LUY93_RS09455 - 1844494..1844814 (-) 321 WP_001120197.1 DUF771 domain-containing protein -
  LUY93_RS09460 - 1844873..1845505 (+) 633 WP_000275058.1 hypothetical protein -
  LUY93_RS09465 - 1845520..1845660 (-) 141 WP_000939496.1 hypothetical protein -
  LUY93_RS09470 - 1845691..1845885 (-) 195 WP_000388066.1 hypothetical protein -
  LUY93_RS09475 - 1845902..1846654 (-) 753 WP_001148618.1 phage antirepressor KilAC domain-containing protein -
  LUY93_RS09480 - 1846711..1847250 (+) 540 WP_000351243.1 hypothetical protein -
  LUY93_RS09485 - 1847274..1847534 (-) 261 WP_000435341.1 transcriptional regulator -
  LUY93_RS09490 - 1847547..1847786 (-) 240 WP_000548578.1 helix-turn-helix transcriptional regulator -
  LUY93_RS09495 - 1847957..1848664 (+) 708 WP_000094093.1 XRE family transcriptional regulator -
  LUY93_RS09500 - 1848676..1848831 (+) 156 WP_001049399.1 hypothetical protein -
  LUY93_RS09505 - 1848818..1849003 (+) 186 WP_001089804.1 hypothetical protein -
  LUY93_RS09510 - 1849203..1849370 (+) 168 WP_000705238.1 hypothetical protein -
  LUY93_RS09515 - 1849510..1850049 (+) 540 WP_000391618.1 type II toxin-antitoxin system PemK/MazF family toxin -
  LUY93_RS09520 - 1850222..1851259 (+) 1038 WP_061644205.1 site-specific integrase -
  LUY93_RS09525 sph 1851316..1852140 (+) 825 Protein_1846 sphingomyelin phosphodiesterase -
  LUY93_RS09530 lukG 1852378..1853394 (-) 1017 WP_000595324.1 bi-component leukocidin LukGH subunit G -
  LUY93_RS09535 lukH 1853416..1854471 (-) 1056 WP_000791407.1 bi-component leukocidin LukGH subunit H -
  LUY93_RS09540 - 1854906..1856129 (+) 1224 WP_000206638.1 ArgE/DapE family deacylase -
  LUY93_RS09545 - 1856501..1857346 (-) 846 WP_000812008.1 class I SAM-dependent methyltransferase -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=637662 LUY93_RS09420 WP_000934770.1 1839668..1840138(-) (ssbA) [Staphylococcus aureus strain 3144_IIV_ST8]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=637662 LUY93_RS09420 WP_000934770.1 1839668..1840138(-) (ssbA) [Staphylococcus aureus strain 3144_IIV_ST8]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628
  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365