Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LUY98_RS14315 | Genome accession | NZ_CP089497 |
| Coordinates | 2884870..2885340 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain 3045_IIV_ST8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2868052..2890672 | 2884870..2885340 | within | 0 |
Gene organization within MGE regions
Location: 2868052..2890672
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUY98_RS14185 | - | 2868052..2869275 (-) | 1224 | WP_000206644.1 | ArgE/DapE family deacylase | - |
| LUY98_RS14190 | - | 2869706..2870761 (+) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| LUY98_RS14195 | - | 2870783..2871802 (+) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| LUY98_RS14200 | sph | 2872065..2872889 (-) | 825 | Protein_2757 | sphingomyelin phosphodiesterase | - |
| LUY98_RS14205 | - | 2872946..2873983 (-) | 1038 | WP_000857181.1 | site-specific integrase | - |
| LUY98_RS14210 | - | 2874046..2874288 (-) | 243 | WP_000427213.1 | hypothetical protein | - |
| LUY98_RS14215 | - | 2874299..2875282 (-) | 984 | WP_001558608.1 | glycosyltransferase family 2 protein | - |
| LUY98_RS14220 | - | 2875382..2875564 (-) | 183 | WP_000694772.1 | hypothetical protein | - |
| LUY98_RS14225 | - | 2875794..2876378 (-) | 585 | WP_000825943.1 | hypothetical protein | - |
| LUY98_RS14230 | - | 2876434..2876619 (-) | 186 | WP_000109193.1 | hypothetical protein | - |
| LUY98_RS14235 | - | 2876616..2876762 (-) | 147 | WP_001049401.1 | hypothetical protein | - |
| LUY98_RS14240 | - | 2876774..2877484 (-) | 711 | WP_000094091.1 | XRE family transcriptional regulator | - |
| LUY98_RS14245 | - | 2877656..2877895 (+) | 240 | WP_000548575.1 | helix-turn-helix transcriptional regulator | - |
| LUY98_RS14250 | - | 2877911..2878126 (+) | 216 | WP_001025405.1 | MW1434 family type I TA system toxin | - |
| LUY98_RS14255 | - | 2878115..2878444 (-) | 330 | WP_000128908.1 | hypothetical protein | - |
| LUY98_RS14260 | - | 2878495..2879247 (+) | 753 | WP_001148635.1 | phage antirepressor KilAC domain-containing protein | - |
| LUY98_RS14265 | - | 2879263..2879460 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| LUY98_RS14270 | - | 2879447..2879827 (-) | 381 | Protein_2771 | DUF2513 domain-containing protein | - |
| LUY98_RS14275 | - | 2879882..2880205 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| LUY98_RS14280 | - | 2880202..2880363 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| LUY98_RS14285 | - | 2880458..2880760 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| LUY98_RS14290 | - | 2880765..2881025 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| LUY98_RS14295 | - | 2881034..2881297 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LUY98_RS14300 | - | 2881306..2883249 (+) | 1944 | WP_000700569.1 | AAA family ATPase | - |
| LUY98_RS14305 | - | 2883251..2884171 (+) | 921 | WP_061843478.1 | recombinase RecT | - |
| LUY98_RS14310 | - | 2884252..2884869 (+) | 618 | WP_078065545.1 | MBL fold metallo-hydrolase | - |
| LUY98_RS14315 | ssbA | 2884870..2885340 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| LUY98_RS14320 | - | 2885370..2886263 (+) | 894 | WP_000148321.1 | DnaD domain-containing protein | - |
| LUY98_RS14325 | - | 2886270..2886488 (+) | 219 | WP_000338529.1 | hypothetical protein | - |
| LUY98_RS14330 | - | 2886497..2886901 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LUY98_RS14335 | - | 2886914..2887282 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| LUY98_RS14340 | - | 2887286..2887528 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| LUY98_RS14345 | - | 2887543..2887797 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| LUY98_RS14350 | - | 2887784..2887954 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| LUY98_RS14355 | - | 2887947..2888483 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| LUY98_RS14360 | - | 2888520..2888765 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| LUY98_RS14365 | - | 2888762..2888968 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| LUY98_RS14370 | - | 2888965..2889351 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| LUY98_RS14375 | rinB | 2889348..2889497 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LUY98_RS14380 | - | 2889497..2889697 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| LUY98_RS14385 | - | 2889725..2890141 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| LUY98_RS14390 | - | 2890373..2890672 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=637586 LUY98_RS14315 WP_000610648.1 2884870..2885340(+) (ssbA) [Staphylococcus aureus strain 3045_IIV_ST8]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=637586 LUY98_RS14315 WP_000610648.1 2884870..2885340(+) (ssbA) [Staphylococcus aureus strain 3045_IIV_ST8]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |