Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LUY91_RS15065 | Genome accession | NZ_CP089495 |
| Coordinates | 2976624..2977094 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain E1202_II_ST496 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2965502..2982793 | 2976624..2977094 | within | 0 |
Gene organization within MGE regions
Location: 2965502..2982793
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUY91_RS14965 | - | 2965502..2966539 (-) | 1038 | WP_000857198.1 | site-specific integrase | - |
| LUY91_RS14970 | - | 2966712..2967251 (-) | 540 | WP_000391618.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LUY91_RS14975 | - | 2967391..2967558 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| LUY91_RS14980 | - | 2967758..2967943 (-) | 186 | WP_001089804.1 | hypothetical protein | - |
| LUY91_RS14985 | - | 2967930..2968085 (-) | 156 | WP_001049399.1 | hypothetical protein | - |
| LUY91_RS14990 | - | 2968097..2968804 (-) | 708 | WP_000094093.1 | XRE family transcriptional regulator | - |
| LUY91_RS14995 | - | 2968975..2969280 (+) | 306 | WP_407535437.1 | helix-turn-helix transcriptional regulator | - |
| LUY91_RS15000 | - | 2969228..2969488 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| LUY91_RS15005 | - | 2969512..2970051 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| LUY91_RS15010 | - | 2970108..2970860 (+) | 753 | WP_001148618.1 | phage antirepressor KilAC domain-containing protein | - |
| LUY91_RS15015 | - | 2970877..2971071 (+) | 195 | WP_000388066.1 | hypothetical protein | - |
| LUY91_RS15020 | - | 2971102..2971242 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| LUY91_RS15025 | - | 2971257..2971889 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| LUY91_RS15030 | - | 2971948..2972268 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LUY91_RS15035 | - | 2972265..2972426 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| LUY91_RS15040 | - | 2972519..2972779 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| LUY91_RS15045 | - | 2972788..2973051 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LUY91_RS15050 | - | 2973060..2975003 (+) | 1944 | WP_000700565.1 | AAA family ATPase | - |
| LUY91_RS15055 | - | 2975005..2975925 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| LUY91_RS15060 | - | 2976006..2976623 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| LUY91_RS15065 | ssbA | 2976624..2977094 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| LUY91_RS15070 | - | 2977124..2978008 (+) | 885 | WP_000148301.1 | DnaD domain protein | - |
| LUY91_RS15075 | - | 2978015..2978233 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| LUY91_RS15080 | - | 2978242..2978646 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LUY91_RS15085 | - | 2978659..2979027 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| LUY91_RS15090 | - | 2979031..2979273 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| LUY91_RS15095 | - | 2979338..2979787 (+) | 450 | WP_000982711.1 | YopX family protein | - |
| LUY91_RS15100 | - | 2979784..2980293 (+) | 510 | WP_001105598.1 | hypothetical protein | - |
| LUY91_RS15105 | - | 2980290..2980700 (+) | 411 | WP_000197967.1 | hypothetical protein | - |
| LUY91_RS15110 | - | 2980693..2981229 (+) | 537 | WP_001066444.1 | dUTPase | - |
| LUY91_RS15115 | - | 2981266..2981472 (+) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| LUY91_RS15120 | rinB | 2981469..2981618 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LUY91_RS15125 | - | 2981618..2981818 (+) | 201 | WP_000265039.1 | DUF1514 family protein | - |
| LUY91_RS15130 | - | 2981846..2982262 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| LUY91_RS15135 | - | 2982494..2982793 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=637543 LUY91_RS15065 WP_000934770.1 2976624..2977094(+) (ssbA) [Staphylococcus aureus strain E1202_II_ST496]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=637543 LUY91_RS15065 WP_000934770.1 2976624..2977094(+) (ssbA) [Staphylococcus aureus strain E1202_II_ST496]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |