Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LUZ07_RS14725 | Genome accession | NZ_CP089476 |
| Coordinates | 2943060..2943530 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 3596_II_ST8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2913527..2949229 | 2943060..2943530 | within | 0 |
Gene organization within MGE regions
Location: 2913527..2949229
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LUZ07_RS14535 | - | 2913527..2914153 (-) | 627 | WP_000522384.1 | nitroreductase family protein | - |
| LUZ07_RS14540 | - | 2914350..2915609 (+) | 1260 | WP_000120305.1 | SdrH family protein | - |
| LUZ07_RS14545 | mroQ | 2915634..2916377 (-) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| LUZ07_RS14550 | groES | 2916552..2916836 (+) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| LUZ07_RS14555 | groL | 2916912..2918528 (+) | 1617 | WP_000240653.1 | chaperonin GroEL | - |
| LUZ07_RS14560 | - | 2918623..2919169 (-) | 547 | Protein_2835 | site-specific integrase | - |
| LUZ07_RS14565 | - | 2919230..2919442 (+) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| LUZ07_RS14570 | - | 2919439..2920029 (+) | 591 | WP_001293058.1 | terminase small subunit | - |
| LUZ07_RS14575 | - | 2920347..2920783 (+) | 437 | Protein_2838 | hypothetical protein | - |
| LUZ07_RS14580 | - | 2920889..2921332 (+) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| LUZ07_RS14585 | - | 2922151..2923323 (-) | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| LUZ07_RS14590 | - | 2923517..2924824 (-) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| LUZ07_RS14595 | - | 2924985..2925896 (+) | 912 | WP_000825510.1 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| LUZ07_RS14600 | - | 2925958..2926803 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| LUZ07_RS14605 | - | 2927175..2928398 (-) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| LUZ07_RS14610 | lukH | 2928833..2929888 (+) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| LUZ07_RS14615 | lukG | 2929910..2930926 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| LUZ07_RS14620 | sph | 2931164..2931988 (-) | 825 | Protein_2847 | sphingomyelin phosphodiesterase | - |
| LUZ07_RS14625 | - | 2932045..2933082 (-) | 1038 | WP_000857198.1 | site-specific integrase | - |
| LUZ07_RS14630 | - | 2933255..2933794 (-) | 540 | WP_000391618.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LUZ07_RS14635 | - | 2933934..2934101 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| LUZ07_RS14640 | - | 2934301..2934486 (-) | 186 | WP_001089804.1 | hypothetical protein | - |
| LUZ07_RS14645 | - | 2934473..2934628 (-) | 156 | WP_001049399.1 | hypothetical protein | - |
| LUZ07_RS14650 | - | 2934640..2935347 (-) | 708 | WP_000094093.1 | XRE family transcriptional regulator | - |
| LUZ07_RS14655 | - | 2935394..2935651 (+) | 258 | WP_001143615.1 | helix-turn-helix transcriptional regulator | - |
| LUZ07_RS14660 | - | 2935664..2935924 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| LUZ07_RS14665 | - | 2935948..2936487 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| LUZ07_RS14670 | - | 2936544..2937296 (+) | 753 | WP_001148618.1 | phage antirepressor KilAC domain-containing protein | - |
| LUZ07_RS14675 | - | 2937313..2937507 (+) | 195 | WP_000388066.1 | hypothetical protein | - |
| LUZ07_RS14680 | - | 2937538..2937678 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| LUZ07_RS14685 | - | 2937693..2938325 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| LUZ07_RS14690 | - | 2938384..2938704 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LUZ07_RS14695 | - | 2938701..2938862 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| LUZ07_RS14700 | - | 2938955..2939215 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| LUZ07_RS14705 | - | 2939224..2939487 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LUZ07_RS14710 | - | 2939496..2941439 (+) | 1944 | WP_000700565.1 | AAA family ATPase | - |
| LUZ07_RS14715 | - | 2941441..2942361 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| LUZ07_RS14720 | - | 2942442..2943059 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| LUZ07_RS14725 | ssbA | 2943060..2943530 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| LUZ07_RS14730 | - | 2943560..2944444 (+) | 885 | WP_000148301.1 | DnaD domain protein | - |
| LUZ07_RS14735 | - | 2944451..2944669 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| LUZ07_RS14740 | - | 2944678..2945082 (+) | 405 | WP_000401964.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LUZ07_RS14745 | - | 2945095..2945463 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| LUZ07_RS14750 | - | 2945467..2945709 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| LUZ07_RS14755 | - | 2945774..2946223 (+) | 450 | WP_000982711.1 | YopX family protein | - |
| LUZ07_RS14760 | - | 2946220..2946729 (+) | 510 | WP_001105598.1 | hypothetical protein | - |
| LUZ07_RS14765 | - | 2946726..2947136 (+) | 411 | WP_000197967.1 | hypothetical protein | - |
| LUZ07_RS14770 | - | 2947129..2947665 (+) | 537 | WP_001066444.1 | dUTPase | - |
| LUZ07_RS14775 | - | 2947702..2947908 (+) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| LUZ07_RS14780 | rinB | 2947905..2948054 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LUZ07_RS14785 | - | 2948054..2948254 (+) | 201 | WP_000265039.1 | DUF1514 family protein | - |
| LUZ07_RS14790 | - | 2948282..2948698 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| LUZ07_RS14795 | - | 2948930..2949229 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=637103 LUZ07_RS14725 WP_000934770.1 2943060..2943530(+) (ssbA) [Staphylococcus aureus strain 3596_II_ST8]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=637103 LUZ07_RS14725 WP_000934770.1 2943060..2943530(+) (ssbA) [Staphylococcus aureus strain 3596_II_ST8]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |