Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   LUZ07_RS04865 Genome accession   NZ_CP089476
Coordinates   966551..967021 (-) Length   156 a.a.
NCBI ID   WP_000934770.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 3596_II_ST8     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 934826..979501 966551..967021 within 0


Gene organization within MGE regions


Location: 934826..979501
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LUZ07_RS04650 - 934826..935209 (-) 384 WP_001251275.1 hypothetical protein -
  LUZ07_RS04655 - 935196..935507 (-) 312 WP_000344116.1 DUF3467 domain-containing protein -
  LUZ07_RS04660 - 935904..937349 (-) 1446 WP_407567837.1 SH3 domain-containing protein -
  LUZ07_RS04665 - 937330..937767 (-) 438 WP_000354133.1 phage holin -
  LUZ07_RS04670 - 937823..938218 (-) 396 WP_000398876.1 hypothetical protein -
  LUZ07_RS04675 - 938224..939396 (-) 1173 WP_029060271.1 BppU family phage baseplate upper protein -
  LUZ07_RS04680 - 939409..941178 (-) 1770 Protein_896 glucosaminidase domain-containing protein -
  LUZ07_RS04685 - 941289..941909 (-) 621 WP_046377067.1 AP2 domain-containing protein -
  LUZ07_RS04690 - 942158..942265 (-) 108 Protein_898 hypothetical protein -
  LUZ07_RS04695 - 942402..942701 (-) 300 WP_000466778.1 DUF2951 domain-containing protein -
  LUZ07_RS04700 - 942741..942914 (-) 174 WP_000782199.1 XkdX family protein -
  LUZ07_RS04705 - 942918..943295 (-) 378 WP_000705897.1 DUF2977 domain-containing protein -
  LUZ07_RS04710 - 943295..945118 (-) 1824 WP_407567838.1 phage baseplate upper protein -
  LUZ07_RS04715 - 945118..947016 (-) 1899 WP_407567839.1 hypothetical protein -
  LUZ07_RS04720 - 947029..948915 (-) 1887 WP_001144709.1 SGNH/GDSL hydrolase family protein -
  LUZ07_RS04725 - 948926..949861 (-) 936 WP_000560196.1 phage tail domain-containing protein -
  LUZ07_RS04730 - 949876..952845 (-) 2970 WP_000414235.1 terminase -
  LUZ07_RS04735 - 952848..953189 (-) 342 WP_001580347.1 hypothetical protein -
  LUZ07_RS04740 - 953210..953704 (-) 495 WP_000141082.1 tail assembly chaperone -
  LUZ07_RS04745 - 953766..954326 (-) 561 WP_000046067.1 hypothetical protein -
  LUZ07_RS04750 - 954313..954750 (-) 438 WP_000270196.1 DUF3168 domain-containing protein -
  LUZ07_RS04755 - 954763..955176 (-) 414 WP_001151335.1 HK97-gp10 family putative phage morphogenesis protein -
  LUZ07_RS04760 - 955163..955498 (-) 336 WP_000482986.1 phage head closure protein -
  LUZ07_RS04765 - 955491..955805 (-) 315 WP_000338935.1 phage head-tail connector protein -
  LUZ07_RS04770 - 955805..956131 (-) 327 WP_000278799.1 Rho termination factor N-terminal domain-containing protein -
  LUZ07_RS04775 - 956148..956972 (-) 825 WP_001135558.1 N4-gp56 family major capsid protein -
  LUZ07_RS04780 - 956993..957589 (-) 597 WP_000366932.1 phage scaffolding protein -
  LUZ07_RS04785 - 957687..958667 (-) 981 WP_001795666.1 phage head morphogenesis protein -
  LUZ07_RS04790 - 958606..960024 (-) 1419 WP_000283553.1 phage portal protein -
  LUZ07_RS04795 - 960038..961246 (-) 1209 WP_001606760.1 PBSX family phage terminase large subunit -
  LUZ07_RS04800 - 961239..961733 (-) 495 WP_000594082.1 terminase small subunit -
  LUZ07_RS04805 - 962061..962483 (-) 423 WP_000162702.1 RinA family phage transcriptional activator -
  LUZ07_RS04810 - 962507..962653 (-) 147 WP_000989960.1 hypothetical protein -
  LUZ07_RS04815 - 962654..963019 (-) 366 WP_000989954.1 hypothetical protein -
  LUZ07_RS04820 - 963020..963316 (-) 297 WP_125571265.1 DUF1024 family protein -
  LUZ07_RS04825 - 963309..963617 (-) 309 WP_125571267.1 hypothetical protein -
  LUZ07_RS04830 - 963614..963961 (-) 348 WP_000979209.1 YopX family protein -
  LUZ07_RS04835 - 963958..964359 (-) 402 WP_000695762.1 hypothetical protein -
  LUZ07_RS04840 - 964372..964614 (-) 243 WP_063663525.1 SAV1978 family virulence-associated passenger protein -
  LUZ07_RS04845 - 964618..964986 (-) 369 WP_000101274.1 SA1788 family PVL leukocidin-associated protein -
  LUZ07_RS04850 - 964999..965403 (-) 405 WP_000401964.1 RusA family crossover junction endodeoxyribonuclease -
  LUZ07_RS04855 - 965412..965630 (-) 219 WP_000338528.1 hypothetical protein -
  LUZ07_RS04860 - 965637..966521 (-) 885 WP_000148301.1 DnaD domain protein -
  LUZ07_RS04865 ssbA 966551..967021 (-) 471 WP_000934770.1 single-stranded DNA-binding protein Machinery gene
  LUZ07_RS04870 - 967022..967639 (-) 618 WP_071621397.1 MBL fold metallo-hydrolase -
  LUZ07_RS04875 - 967720..968640 (-) 921 WP_000138472.1 recombinase RecT -
  LUZ07_RS04880 - 968642..970585 (-) 1944 WP_000700577.1 AAA family ATPase -
  LUZ07_RS04885 - 970594..970857 (-) 264 WP_001205732.1 hypothetical protein -
  LUZ07_RS04890 - 970866..971126 (-) 261 WP_000291503.1 DUF1108 family protein -
  LUZ07_RS04895 - 971107..971433 (-) 327 WP_000165362.1 DUF2482 family protein -
  LUZ07_RS04900 - 971528..971689 (-) 162 WP_000066025.1 DUF1270 domain-containing protein -
  LUZ07_RS04905 - 971682..971819 (-) 138 WP_000230552.1 hypothetical protein -
  LUZ07_RS04910 - 971869..972099 (+) 231 WP_000395455.1 hypothetical protein -
  LUZ07_RS04915 tscA 972290..972514 (-) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  LUZ07_RS04920 - 972515..973288 (-) 774 WP_001148549.1 phage antirepressor KilAC domain-containing protein -
  LUZ07_RS04925 - 973311..973538 (-) 228 WP_000192117.1 helix-turn-helix transcriptional regulator -
  LUZ07_RS04930 - 973692..974324 (+) 633 WP_000901358.1 LexA family transcriptional regulator -
  LUZ07_RS04935 - 974375..974920 (+) 546 WP_000391577.1 Ltp family lipoprotein -
  LUZ07_RS04940 - 975036..975716 (+) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  LUZ07_RS04945 - 975923..977308 (+) 1386 WP_000861313.1 recombinase family protein -
  LUZ07_RS04950 rpmF 977425..977598 (-) 174 WP_000290472.1 50S ribosomal protein L32 -
  LUZ07_RS04955 - 977678..978235 (-) 558 WP_000872158.1 DUF177 domain-containing protein -
  LUZ07_RS04960 - 978362..979501 (+) 1140 WP_000843611.1 nucleotidyltransferase -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17713.63 Da        Isoelectric Point: 5.2672

>NTDB_id=637083 LUZ07_RS04865 WP_000934770.1 966551..967021(-) (ssbA) [Staphylococcus aureus strain 3596_II_ST8]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=637083 LUZ07_RS04865 WP_000934770.1 966551..967021(-) (ssbA) [Staphylococcus aureus strain 3596_II_ST8]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628
  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.551
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365