Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LT232_RS00905 Genome accession   NZ_CP089287
Coordinates   149137..149514 (+) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain GSBZ09     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 144137..154514
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT232_RS00870 (LT232_00870) - 144451..145401 (+) 951 WP_007408319.1 magnesium transporter CorA family protein -
  LT232_RS00875 (LT232_00875) comGA 145595..146665 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LT232_RS00880 (LT232_00880) comGB 146652..147689 (+) 1038 WP_094031834.1 competence type IV pilus assembly protein ComGB Machinery gene
  LT232_RS00885 (LT232_00885) comGC 147694..148002 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LT232_RS00890 (LT232_00890) comGD 147992..148429 (+) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  LT232_RS00895 (LT232_00895) comGE 148413..148727 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LT232_RS00900 (LT232_00900) comGF 148636..149136 (+) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  LT232_RS00905 (LT232_00905) comGG 149137..149514 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  LT232_RS00910 (LT232_00910) - 149571..149750 (+) 180 WP_003153093.1 YqzE family protein -
  LT232_RS00915 (LT232_00915) - 149790..150119 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LT232_RS00920 (LT232_00920) tapA 150378..151049 (+) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  LT232_RS00925 (LT232_00925) sipW 151021..151605 (+) 585 WP_015240205.1 signal peptidase I SipW -
  LT232_RS00930 (LT232_00930) tasA 151670..152455 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  LT232_RS00935 (LT232_00935) sinR 152503..152838 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LT232_RS00940 (LT232_00940) sinI 152872..153045 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  LT232_RS00945 (LT232_00945) - 153222..154016 (-) 795 WP_076424968.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=636133 LT232_RS00905 WP_012117980.1 149137..149514(+) (comGG) [Bacillus velezensis strain GSBZ09]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=636133 LT232_RS00905 WP_012117980.1 149137..149514(+) (comGG) [Bacillus velezensis strain GSBZ09]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512