Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LT232_RS00940 | Genome accession | NZ_CP089287 |
| Coordinates | 152872..153045 (-) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain GSBZ09 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 147872..158045
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LT232_RS00890 (LT232_00890) | comGD | 147992..148429 (+) | 438 | WP_043020787.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| LT232_RS00895 (LT232_00895) | comGE | 148413..148727 (+) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| LT232_RS00900 (LT232_00900) | comGF | 148636..149136 (+) | 501 | WP_257899725.1 | competence type IV pilus minor pilin ComGF | - |
| LT232_RS00905 (LT232_00905) | comGG | 149137..149514 (+) | 378 | WP_012117980.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LT232_RS00910 (LT232_00910) | - | 149571..149750 (+) | 180 | WP_003153093.1 | YqzE family protein | - |
| LT232_RS00915 (LT232_00915) | - | 149790..150119 (-) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| LT232_RS00920 (LT232_00920) | tapA | 150378..151049 (+) | 672 | WP_124934997.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LT232_RS00925 (LT232_00925) | sipW | 151021..151605 (+) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| LT232_RS00930 (LT232_00930) | tasA | 151670..152455 (+) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| LT232_RS00935 (LT232_00935) | sinR | 152503..152838 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| LT232_RS00940 (LT232_00940) | sinI | 152872..153045 (-) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| LT232_RS00945 (LT232_00945) | - | 153222..154016 (-) | 795 | WP_076424968.1 | YqhG family protein | - |
| LT232_RS00950 (LT232_00950) | - | 154038..155708 (-) | 1671 | WP_124934996.1 | DEAD/DEAH box helicase | - |
| LT232_RS00955 (LT232_00955) | gcvT | 156132..157232 (+) | 1101 | WP_032866432.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=636135 LT232_RS00940 WP_003153105.1 152872..153045(-) (sinI) [Bacillus velezensis strain GSBZ09]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=636135 LT232_RS00940 WP_003153105.1 152872..153045(-) (sinI) [Bacillus velezensis strain GSBZ09]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |