Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LT232_RS00940 Genome accession   NZ_CP089287
Coordinates   152872..153045 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain GSBZ09     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 147872..158045
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LT232_RS00890 (LT232_00890) comGD 147992..148429 (+) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  LT232_RS00895 (LT232_00895) comGE 148413..148727 (+) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LT232_RS00900 (LT232_00900) comGF 148636..149136 (+) 501 WP_257899725.1 competence type IV pilus minor pilin ComGF -
  LT232_RS00905 (LT232_00905) comGG 149137..149514 (+) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  LT232_RS00910 (LT232_00910) - 149571..149750 (+) 180 WP_003153093.1 YqzE family protein -
  LT232_RS00915 (LT232_00915) - 149790..150119 (-) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LT232_RS00920 (LT232_00920) tapA 150378..151049 (+) 672 WP_124934997.1 amyloid fiber anchoring/assembly protein TapA -
  LT232_RS00925 (LT232_00925) sipW 151021..151605 (+) 585 WP_015240205.1 signal peptidase I SipW -
  LT232_RS00930 (LT232_00930) tasA 151670..152455 (+) 786 WP_007408329.1 biofilm matrix protein TasA -
  LT232_RS00935 (LT232_00935) sinR 152503..152838 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LT232_RS00940 (LT232_00940) sinI 152872..153045 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  LT232_RS00945 (LT232_00945) - 153222..154016 (-) 795 WP_076424968.1 YqhG family protein -
  LT232_RS00950 (LT232_00950) - 154038..155708 (-) 1671 WP_124934996.1 DEAD/DEAH box helicase -
  LT232_RS00955 (LT232_00955) gcvT 156132..157232 (+) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=636135 LT232_RS00940 WP_003153105.1 152872..153045(-) (sinI) [Bacillus velezensis strain GSBZ09]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=636135 LT232_RS00940 WP_003153105.1 152872..153045(-) (sinI) [Bacillus velezensis strain GSBZ09]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702