Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LTK15_RS00880 | Genome accession | NZ_CP089154 |
| Coordinates | 172826..173296 (+) | Length | 156 a.a. |
| NCBI ID | WP_000610648.1 | Uniprot ID | A0A090M1W2 |
| Organism | Staphylococcus aureus strain UNC_SaCF36 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 156513..202581 | 172826..173296 | within | 0 |
Gene organization within MGE regions
Location: 156513..202581
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LTK15_RS00755 (LTK15_00755) | - | 156513..157736 (-) | 1224 | WP_000206615.1 | ArgE/DapE family deacylase | - |
| LTK15_RS00760 (LTK15_00760) | - | 158167..159222 (+) | 1056 | WP_000791399.1 | leukocidin family pore-forming toxin | - |
| LTK15_RS00765 (LTK15_00765) | - | 159244..160263 (+) | 1020 | WP_000595616.1 | leukocidin/hemolysin toxin family protein | - |
| LTK15_RS00770 (LTK15_00770) | sph | 160520..161344 (-) | 825 | Protein_139 | sphingomyelin phosphodiesterase | - |
| LTK15_RS00775 (LTK15_00775) | - | 161401..162438 (-) | 1038 | WP_000857191.1 | site-specific integrase | - |
| LTK15_RS00780 (LTK15_00780) | - | 162497..162961 (-) | 465 | WP_000825947.1 | hypothetical protein | - |
| LTK15_RS00785 (LTK15_00785) | - | 163061..163243 (-) | 183 | WP_000705248.1 | hypothetical protein | - |
| LTK15_RS00790 (LTK15_00790) | - | 163447..163788 (-) | 342 | WP_000591749.1 | hypothetical protein | - |
| LTK15_RS00795 (LTK15_00795) | - | 163794..164726 (-) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| LTK15_RS00800 (LTK15_00800) | - | 164742..165455 (-) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| LTK15_RS00805 (LTK15_00805) | - | 165418..165591 (+) | 174 | WP_001801500.1 | hypothetical protein | - |
| LTK15_RS00810 (LTK15_00810) | - | 165588..165851 (+) | 264 | WP_000854073.1 | helix-turn-helix transcriptional regulator | - |
| LTK15_RS00815 (LTK15_00815) | - | 165867..166082 (+) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| LTK15_RS00820 (LTK15_00820) | - | 166071..166400 (-) | 330 | WP_000128907.1 | hypothetical protein | - |
| LTK15_RS00825 (LTK15_00825) | - | 166451..167203 (+) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| LTK15_RS00830 (LTK15_00830) | - | 167219..167416 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| LTK15_RS00835 (LTK15_00835) | - | 167403..167783 (-) | 381 | WP_000762519.1 | DUF2513 domain-containing protein | - |
| LTK15_RS00840 (LTK15_00840) | - | 167838..168161 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| LTK15_RS00845 (LTK15_00845) | - | 168158..168319 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| LTK15_RS00850 (LTK15_00850) | - | 168414..168716 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| LTK15_RS00855 (LTK15_00855) | - | 168721..168981 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| LTK15_RS00860 (LTK15_00860) | - | 168990..169253 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LTK15_RS00865 (LTK15_00865) | - | 169262..171205 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| LTK15_RS00870 (LTK15_00870) | - | 171207..172127 (+) | 921 | WP_000138475.1 | recombinase RecT | - |
| LTK15_RS00875 (LTK15_00875) | - | 172208..172825 (+) | 618 | WP_073394849.1 | MBL fold metallo-hydrolase | - |
| LTK15_RS00880 (LTK15_00880) | ssbA | 172826..173296 (+) | 471 | WP_000610648.1 | single-stranded DNA-binding protein | Machinery gene |
| LTK15_RS00885 (LTK15_00885) | - | 173326..174219 (+) | 894 | WP_000148323.1 | DnaD domain-containing protein | - |
| LTK15_RS00890 (LTK15_00890) | - | 174226..174444 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| LTK15_RS00895 (LTK15_00895) | - | 174453..174857 (+) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LTK15_RS00900 (LTK15_00900) | - | 174870..175238 (+) | 369 | WP_000101288.1 | SA1788 family PVL leukocidin-associated protein | - |
| LTK15_RS00905 (LTK15_00905) | - | 175242..175484 (+) | 243 | WP_000131370.1 | SAV1978 family virulence-associated passenger protein | - |
| LTK15_RS00910 (LTK15_00910) | - | 175499..175753 (+) | 255 | WP_001065097.1 | DUF1024 family protein | - |
| LTK15_RS00915 (LTK15_00915) | - | 175740..175910 (+) | 171 | WP_000714403.1 | hypothetical protein | - |
| LTK15_RS00920 (LTK15_00920) | - | 175903..176439 (+) | 537 | WP_001066447.1 | dUTP diphosphatase | - |
| LTK15_RS00925 (LTK15_00925) | - | 176476..176721 (+) | 246 | WP_001282074.1 | hypothetical protein | - |
| LTK15_RS00930 (LTK15_00930) | - | 176718..176924 (+) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| LTK15_RS00935 (LTK15_00935) | - | 176921..177307 (+) | 387 | WP_000592207.1 | hypothetical protein | - |
| LTK15_RS00940 (LTK15_00940) | rinB | 177304..177453 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LTK15_RS00945 (LTK15_00945) | - | 177453..177653 (+) | 201 | WP_001622114.1 | DUF1514 family protein | - |
| LTK15_RS00950 (LTK15_00950) | - | 177681..178097 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| LTK15_RS00955 (LTK15_00955) | - | 178329..178628 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| LTK15_RS00960 (LTK15_00960) | - | 178758..179102 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| LTK15_RS00965 (LTK15_00965) | - | 179099..180760 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| LTK15_RS00970 (LTK15_00970) | - | 180776..181963 (+) | 1188 | WP_000025274.1 | phage portal protein | - |
| LTK15_RS00975 (LTK15_00975) | - | 181947..182684 (+) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| LTK15_RS00980 (LTK15_00980) | - | 182708..183853 (+) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| LTK15_RS00985 (LTK15_00985) | - | 183873..184157 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| LTK15_RS00990 (LTK15_00990) | - | 184147..184431 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| LTK15_RS00995 (LTK15_00995) | - | 184415..184777 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| LTK15_RS01000 (LTK15_01000) | - | 184774..185178 (+) | 405 | WP_000114227.1 | HK97 gp10 family phage protein | - |
| LTK15_RS01005 (LTK15_01005) | - | 185175..185582 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| LTK15_RS01010 (LTK15_01010) | - | 185583..186227 (+) | 645 | WP_000268733.1 | major tail protein | - |
| LTK15_RS01015 (LTK15_01015) | - | 186281..186493 (+) | 213 | WP_078101489.1 | Ig-like domain-containing protein | - |
| LTK15_RS01020 (LTK15_01020) | gpG | 186543..186893 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| LTK15_RS01025 (LTK15_01025) | gpGT | 186944..187081 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| LTK15_RS01030 (LTK15_01030) | - | 187138..191667 (+) | 4530 | WP_232044295.1 | phage tail tape measure protein | - |
| LTK15_RS01035 (LTK15_01035) | - | 191664..193148 (+) | 1485 | WP_000567408.1 | phage distal tail protein | - |
| LTK15_RS01040 (LTK15_01040) | - | 193164..196949 (+) | 3786 | WP_196579352.1 | phage tail spike protein | - |
| LTK15_RS01045 (LTK15_01045) | - | 196939..197091 (+) | 153 | WP_001153681.1 | hypothetical protein | - |
| LTK15_RS01050 (LTK15_01050) | - | 197138..197425 (+) | 288 | WP_001040261.1 | hypothetical protein | - |
| LTK15_RS01055 (LTK15_01055) | - | 197483..197779 (+) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| LTK15_RS01060 (LTK15_01060) | pepG1 | 197971..198105 (+) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| LTK15_RS01065 (LTK15_01065) | - | 198158..198265 (-) | 108 | WP_001791821.1 | hypothetical protein | - |
| LTK15_RS01070 (LTK15_01070) | - | 198317..198571 (+) | 255 | WP_000611512.1 | phage holin | - |
| LTK15_RS01075 (LTK15_01075) | - | 198583..199338 (+) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| LTK15_RS01080 (LTK15_01080) | sak | 199529..200020 (+) | 492 | WP_000919350.1 | staphylokinase | - |
| LTK15_RS01085 (LTK15_01085) | - | 200666..201004 (+) | 339 | Protein_202 | SH3 domain-containing protein | - |
| LTK15_RS01090 (LTK15_01090) | - | 201099..201548 (-) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| LTK15_RS01095 (LTK15_01095) | scn | 202231..202581 (+) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=635346 LTK15_RS00880 WP_000610648.1 172826..173296(+) (ssbA) [Staphylococcus aureus strain UNC_SaCF36]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=635346 LTK15_RS00880 WP_000610648.1 172826..173296(+) (ssbA) [Staphylococcus aureus strain UNC_SaCF36]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |