Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   N7980_RS08820 Genome accession   NZ_CP106671
Coordinates   1687742..1688125 (+) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM116301     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1682742..1693125
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N7980_RS08790 (N7980_08790) corA 1683196..1684149 (+) 954 WP_029317911.1 magnesium transporter CorA -
  N7980_RS08795 (N7980_08795) comGA 1684560..1685630 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  N7980_RS08800 (N7980_08800) comGB 1685617..1686654 (+) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  N7980_RS08805 (N7980_08805) comGC 1686668..1686964 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  N7980_RS08810 (N7980_08810) comGD 1686954..1687385 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  N7980_RS08815 (N7980_08815) comGE 1687369..1687716 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  N7980_RS08820 (N7980_08820) comGF 1687742..1688125 (+) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  N7980_RS08825 (N7980_08825) comGG 1688126..1688500 (+) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  N7980_RS08830 (N7980_08830) spoIITA 1688571..1688750 (+) 180 WP_003230176.1 YqzE family protein -
  N7980_RS08835 (N7980_08835) yqzG 1688792..1689118 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  N7980_RS08840 (N7980_08840) tapA 1689390..1690151 (+) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  N7980_RS08845 (N7980_08845) sipW 1690135..1690707 (+) 573 WP_003246088.1 signal peptidase I SipW -
  N7980_RS08850 (N7980_08850) tasA 1690771..1691556 (+) 786 WP_015251717.1 biofilm matrix protein TasA -
  N7980_RS08855 (N7980_08855) sinR 1691649..1691984 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N7980_RS08860 (N7980_08860) sinI 1692018..1692191 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=635332 N7980_RS08820 WP_041850015.1 1687742..1688125(+) (comGF) [Bacillus subtilis strain SRCM116301]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=635332 N7980_RS08820 WP_041850015.1 1687742..1688125(+) (comGF) [Bacillus subtilis strain SRCM116301]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984