Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LSG23_RS12530 Genome accession   NZ_CP088973
Coordinates   2581103..2581480 (-) Length   125 a.a.
NCBI ID   WP_077722592.1    Uniprot ID   -
Organism   Bacillus velezensis strain CMML20-16     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2576103..2586480
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LSG23_RS12490 (LSG23_12470) - 2576602..2577396 (+) 795 WP_014305407.1 YqhG family protein -
  LSG23_RS12495 (LSG23_12475) sinI 2577573..2577746 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LSG23_RS12500 (LSG23_12480) sinR 2577780..2578115 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LSG23_RS12505 (LSG23_12485) tasA 2578163..2578948 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LSG23_RS12510 (LSG23_12490) sipW 2579012..2579596 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LSG23_RS12515 (LSG23_12495) tapA 2579568..2580239 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  LSG23_RS12520 (LSG23_12500) - 2580498..2580827 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LSG23_RS12525 (LSG23_12505) - 2580867..2581046 (-) 180 WP_003153093.1 YqzE family protein -
  LSG23_RS12530 (LSG23_12510) comGG 2581103..2581480 (-) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  LSG23_RS12535 (LSG23_12515) comGF 2581481..2581981 (-) 501 WP_232213409.1 competence type IV pilus minor pilin ComGF -
  LSG23_RS12540 (LSG23_12520) comGE 2581890..2582204 (-) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  LSG23_RS12545 (LSG23_12525) comGD 2582188..2582625 (-) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene
  LSG23_RS12550 (LSG23_12530) comGC 2582615..2582923 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LSG23_RS12555 (LSG23_12535) comGB 2582928..2583965 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  LSG23_RS12560 (LSG23_12540) comGA 2583952..2585022 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  LSG23_RS12565 (LSG23_12545) - 2585214..2586164 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14209.17 Da        Isoelectric Point: 9.4395

>NTDB_id=634306 LSG23_RS12530 WP_077722592.1 2581103..2581480(-) (comGG) [Bacillus velezensis strain CMML20-16]
MHKSDGFIYPAILFVSAAVLLVISYTSSDFITRKIFEKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=634306 LSG23_RS12530 WP_077722592.1 2581103..2581480(-) (comGG) [Bacillus velezensis strain CMML20-16]
ATGCACAAATCTGACGGTTTTATATATCCCGCGATTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAATATTTGAGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGCGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504