Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LSG23_RS12495 Genome accession   NZ_CP088973
Coordinates   2577573..2577746 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CMML20-16     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2572573..2582746
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LSG23_RS12480 (LSG23_12460) gcvT 2573390..2574490 (-) 1101 WP_077722591.1 glycine cleavage system aminomethyltransferase GcvT -
  LSG23_RS12485 (LSG23_12465) - 2574914..2576584 (+) 1671 WP_046559872.1 DEAD/DEAH box helicase -
  LSG23_RS12490 (LSG23_12470) - 2576602..2577396 (+) 795 WP_014305407.1 YqhG family protein -
  LSG23_RS12495 (LSG23_12475) sinI 2577573..2577746 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LSG23_RS12500 (LSG23_12480) sinR 2577780..2578115 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LSG23_RS12505 (LSG23_12485) tasA 2578163..2578948 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LSG23_RS12510 (LSG23_12490) sipW 2579012..2579596 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LSG23_RS12515 (LSG23_12495) tapA 2579568..2580239 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  LSG23_RS12520 (LSG23_12500) - 2580498..2580827 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  LSG23_RS12525 (LSG23_12505) - 2580867..2581046 (-) 180 WP_003153093.1 YqzE family protein -
  LSG23_RS12530 (LSG23_12510) comGG 2581103..2581480 (-) 378 WP_077722592.1 competence type IV pilus minor pilin ComGG Machinery gene
  LSG23_RS12535 (LSG23_12515) comGF 2581481..2581981 (-) 501 WP_232213409.1 competence type IV pilus minor pilin ComGF -
  LSG23_RS12540 (LSG23_12520) comGE 2581890..2582204 (-) 315 WP_077722594.1 competence type IV pilus minor pilin ComGE Machinery gene
  LSG23_RS12545 (LSG23_12525) comGD 2582188..2582625 (-) 438 WP_077722595.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=634304 LSG23_RS12495 WP_003153105.1 2577573..2577746(+) (sinI) [Bacillus velezensis strain CMML20-16]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=634304 LSG23_RS12495 WP_003153105.1 2577573..2577746(+) (sinI) [Bacillus velezensis strain CMML20-16]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCTCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702