Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LRX85_RS14425 | Genome accession | NZ_CP088894 |
| Coordinates | 3023097..3023450 (-) | Length | 117 a.a. |
| NCBI ID | WP_004738307.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain XH1935 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3017368..3059545 | 3023097..3023450 | within | 0 |
Gene organization within MGE regions
Location: 3017368..3059545
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRX85_RS14395 (LRX85_14395) | - | 3017368..3018315 (+) | 948 | WP_001254610.1 | LysR substrate-binding domain-containing protein | - |
| LRX85_RS14400 (LRX85_14400) | - | 3018420..3019595 (-) | 1176 | WP_000843784.1 | zinc-binding dehydrogenase | - |
| LRX85_RS14405 (LRX85_14405) | add | 3019999..3020994 (+) | 996 | WP_000629031.1 | adenosine deaminase | - |
| LRX85_RS14415 (LRX85_14415) | - | 3021624..3022784 (-) | 1161 | WP_004738311.1 | tyrosine-type recombinase/integrase | - |
| LRX85_RS14420 (LRX85_14420) | - | 3022873..3023076 (-) | 204 | WP_004738309.1 | hypothetical protein | - |
| LRX85_RS14425 (LRX85_14425) | ssb | 3023097..3023450 (-) | 354 | WP_004738307.1 | single-stranded DNA-binding protein | Machinery gene |
| LRX85_RS14430 (LRX85_14430) | - | 3023438..3023755 (-) | 318 | WP_004738305.1 | hypothetical protein | - |
| LRX85_RS14435 (LRX85_14435) | - | 3023748..3024101 (-) | 354 | WP_004738303.1 | hypothetical protein | - |
| LRX85_RS14440 (LRX85_14440) | - | 3024105..3024623 (-) | 519 | WP_004738302.1 | hypothetical protein | - |
| LRX85_RS14445 (LRX85_14445) | - | 3024691..3025293 (-) | 603 | WP_004738299.1 | hypothetical protein | - |
| LRX85_RS14450 (LRX85_14450) | - | 3025310..3028036 (-) | 2727 | WP_004738296.1 | toprim domain-containing protein | - |
| LRX85_RS14455 (LRX85_14455) | - | 3028046..3028216 (-) | 171 | WP_004738295.1 | hypothetical protein | - |
| LRX85_RS14460 (LRX85_14460) | - | 3028231..3028470 (-) | 240 | WP_004738293.1 | hypothetical protein | - |
| LRX85_RS14465 (LRX85_14465) | - | 3028473..3028673 (-) | 201 | WP_004738291.1 | hypothetical protein | - |
| LRX85_RS14470 (LRX85_14470) | - | 3028757..3029107 (+) | 351 | WP_004738288.1 | hypothetical protein | - |
| LRX85_RS14475 (LRX85_14475) | - | 3029104..3029682 (-) | 579 | WP_004738286.1 | hypothetical protein | - |
| LRX85_RS14480 (LRX85_14480) | - | 3029679..3030002 (-) | 324 | WP_004738284.1 | hypothetical protein | - |
| LRX85_RS14485 (LRX85_14485) | - | 3030418..3031425 (+) | 1008 | WP_004738282.1 | WYL domain-containing protein | - |
| LRX85_RS14490 (LRX85_14490) | - | 3031457..3032266 (+) | 810 | WP_004738281.1 | trypsin-like peptidase domain-containing protein | - |
| LRX85_RS14495 (LRX85_14495) | - | 3032599..3033831 (-) | 1233 | WP_004738280.1 | acyltransferase | - |
| LRX85_RS14500 (LRX85_14500) | - | 3033985..3034338 (-) | 354 | WP_004738279.1 | hypothetical protein | - |
| LRX85_RS14505 (LRX85_14505) | - | 3034343..3034738 (-) | 396 | WP_004738278.1 | hypothetical protein | - |
| LRX85_RS14510 (LRX85_14510) | - | 3034738..3035025 (-) | 288 | WP_004738277.1 | ogr/Delta-like zinc finger family protein | - |
| LRX85_RS18470 | - | 3035144..3035335 (+) | 192 | WP_079270046.1 | Com family DNA-binding transcriptional regulator | - |
| LRX85_RS14515 (LRX85_14515) | - | 3035304..3036095 (+) | 792 | WP_004738276.1 | DNA adenine methylase | - |
| LRX85_RS14520 (LRX85_14520) | - | 3036092..3037309 (-) | 1218 | WP_004738275.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| LRX85_RS14525 (LRX85_14525) | - | 3037313..3037732 (-) | 420 | WP_004738274.1 | phage tail protein | - |
| LRX85_RS14530 (LRX85_14530) | - | 3037747..3041376 (-) | 3630 | WP_004738273.1 | hypothetical protein | - |
| LRX85_RS14535 (LRX85_14535) | - | 3041373..3041441 (-) | 69 | WP_238826551.1 | GpE family phage tail protein | - |
| LRX85_RS14540 (LRX85_14540) | - | 3041501..3041881 (-) | 381 | WP_196085662.1 | phage tail assembly protein | - |
| LRX85_RS14545 (LRX85_14545) | - | 3041943..3042458 (-) | 516 | WP_196085661.1 | phage major tail tube protein | - |
| LRX85_RS14550 (LRX85_14550) | - | 3042470..3043639 (-) | 1170 | WP_004738266.1 | phage tail sheath protein | - |
| LRX85_RS14555 (LRX85_14555) | - | 3043748..3044245 (-) | 498 | WP_196085660.1 | hypothetical protein | - |
| LRX85_RS14560 (LRX85_14560) | - | 3044247..3047246 (-) | 3000 | WP_218264719.1 | phage tail protein | - |
| LRX85_RS14565 (LRX85_14565) | - | 3047247..3047783 (-) | 537 | WP_005112001.1 | phage tail protein I | - |
| LRX85_RS14570 (LRX85_14570) | - | 3047783..3048676 (-) | 894 | WP_254231394.1 | baseplate J/gp47 family protein | - |
| LRX85_RS14575 (LRX85_14575) | - | 3048697..3049053 (-) | 357 | WP_196085348.1 | GPW/gp25 family protein | - |
| LRX85_RS14580 (LRX85_14580) | - | 3049050..3049604 (-) | 555 | WP_196085347.1 | phage baseplate assembly protein V | - |
| LRX85_RS14585 (LRX85_14585) | - | 3049665..3050126 (-) | 462 | WP_032058820.1 | phage virion morphogenesis protein | - |
| LRX85_RS14590 (LRX85_14590) | - | 3050130..3050660 (-) | 531 | WP_005112011.1 | phage tail protein | - |
| LRX85_RS14595 (LRX85_14595) | - | 3050657..3051487 (-) | 831 | WP_156190991.1 | N-acetylmuramidase family protein | - |
| LRX85_RS14600 (LRX85_14600) | - | 3051484..3051741 (-) | 258 | WP_004738245.1 | phage holin family protein | - |
| LRX85_RS14605 (LRX85_14605) | - | 3051738..3052097 (-) | 360 | WP_004703727.1 | putative holin | - |
| LRX85_RS14610 (LRX85_14610) | - | 3052100..3052309 (-) | 210 | WP_004703729.1 | tail protein X | - |
| LRX85_RS14615 (LRX85_14615) | - | 3052306..3052755 (-) | 450 | WP_196085346.1 | head completion/stabilization protein | - |
| LRX85_RS14620 (LRX85_14620) | gpM | 3052856..3053620 (-) | 765 | WP_196085345.1 | phage terminase small subunit | - |
| LRX85_RS14625 (LRX85_14625) | - | 3053627..3054637 (-) | 1011 | WP_001247975.1 | phage major capsid protein, P2 family | - |
| LRX85_RS14630 (LRX85_14630) | - | 3054673..3055533 (-) | 861 | WP_196085344.1 | GPO family capsid scaffolding protein | - |
| LRX85_RS14635 (LRX85_14635) | - | 3055712..3057490 (+) | 1779 | WP_196085343.1 | terminase family protein | - |
| LRX85_RS14640 (LRX85_14640) | - | 3057487..3058533 (+) | 1047 | WP_254231395.1 | phage portal protein | - |
| LRX85_RS14645 (LRX85_14645) | - | 3058544..3058759 (+) | 216 | WP_227552920.1 | hypothetical protein | - |
| LRX85_RS14650 (LRX85_14650) | - | 3058867..3059046 (+) | 180 | WP_000009390.1 | type II toxin-antitoxin system HicA family toxin | - |
| LRX85_RS14655 (LRX85_14655) | - | 3059132..3059545 (+) | 414 | WP_032058837.1 | antitoxin | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13204.83 Da Isoelectric Point: 9.8037
>NTDB_id=633765 LRX85_RS14425 WP_004738307.1 3023097..3023450(-) (ssb) [Acinetobacter baumannii strain XH1935]
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY
Nucleotide
Download Length: 354 bp
>NTDB_id=633765 LRX85_RS14425 WP_004738307.1 3023097..3023450(-) (ssb) [Acinetobacter baumannii strain XH1935]
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
54.545 |
94.017 |
0.513 |
| ssb | Vibrio cholerae strain A1552 |
54.545 |
84.615 |
0.462 |
| ssb | Neisseria gonorrhoeae MS11 |
42.857 |
89.744 |
0.385 |
| ssb | Neisseria meningitidis MC58 |
42.857 |
89.744 |
0.385 |