Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LRP64_RS09000 | Genome accession | NZ_CP088158 |
| Coordinates | 1885667..1886137 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934772.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 697 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1843812..1904140 | 1885667..1886137 | within | 0 |
Gene organization within MGE regions
Location: 1843812..1904140
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRP64_RS08725 (LRP64_08725) | - | 1843812..1844267 (-) | 456 | WP_168360851.1 | DUF4909 domain-containing protein | - |
| LRP64_RS08730 (LRP64_08730) | - | 1844570..1845220 (+) | 651 | WP_001838615.1 | excalibur calcium-binding domain-containing protein | - |
| LRP64_RS08735 (LRP64_08735) | - | 1845301..1846296 (+) | 996 | WP_000070638.1 | DUF4352 domain-containing protein | - |
| LRP64_RS08740 (LRP64_08740) | - | 1846372..1846998 (+) | 627 | WP_000669039.1 | hypothetical protein | - |
| LRP64_RS08745 (LRP64_08745) | - | 1847039..1847380 (+) | 342 | WP_000627534.1 | DUF3969 family protein | - |
| LRP64_RS08750 (LRP64_08750) | - | 1847481..1848053 (+) | 573 | WP_000414219.1 | hypothetical protein | - |
| LRP64_RS08755 (LRP64_08755) | - | 1848363..1849016 (-) | 654 | WP_000657815.1 | hypothetical protein | - |
| LRP64_RS08760 (LRP64_08760) | - | 1849026..1850732 (-) | 1707 | WP_000533463.1 | UvrD-helicase domain-containing protein | - |
| LRP64_RS08765 (LRP64_08765) | - | 1851231..1852126 (-) | 896 | Protein_1726 | tyrosine-type recombinase/integrase | - |
| LRP64_RS08770 (LRP64_08770) | - | 1852300..1853547 (+) | 1248 | Protein_1727 | polysaccharide lyase family 8 super-sandwich domain-containing protein | - |
| LRP64_RS08775 (LRP64_08775) | - | 1853607..1854461 (-) | 855 | WP_001044434.1 | M23 family metallopeptidase | - |
| LRP64_RS08780 (LRP64_08780) | - | 1854712..1855269 (-) | 558 | Protein_1729 | restriction endonuclease subunit S | - |
| LRP64_RS08785 (LRP64_08785) | - | 1855674..1855853 (+) | 180 | WP_000669791.1 | hypothetical protein | - |
| LRP64_RS13785 | - | 1855877..1856185 (+) | 309 | WP_001789576.1 | hypothetical protein | - |
| LRP64_RS08790 (LRP64_08790) | - | 1856164..1856424 (+) | 261 | WP_001791826.1 | hypothetical protein | - |
| LRP64_RS08795 (LRP64_08795) | scn | 1856477..1856827 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| LRP64_RS08800 (LRP64_08800) | - | 1857512..1857961 (+) | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| LRP64_RS08805 (LRP64_08805) | - | 1858056..1858391 (-) | 336 | Protein_1735 | SH3 domain-containing protein | - |
| LRP64_RS08810 (LRP64_08810) | sak | 1859041..1859532 (-) | 492 | WP_000919350.1 | staphylokinase | - |
| LRP64_RS08815 (LRP64_08815) | - | 1859723..1860478 (-) | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| LRP64_RS08820 (LRP64_08820) | - | 1860490..1860744 (-) | 255 | WP_000611512.1 | phage holin | - |
| LRP64_RS08825 (LRP64_08825) | - | 1860796..1860903 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| LRP64_RS08830 (LRP64_08830) | pepG1 | 1860956..1861090 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| LRP64_RS08835 (LRP64_08835) | - | 1861282..1861578 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| LRP64_RS08840 (LRP64_08840) | - | 1861636..1861923 (-) | 288 | WP_001040261.1 | hypothetical protein | - |
| LRP64_RS08845 (LRP64_08845) | - | 1861970..1862122 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| LRP64_RS08850 (LRP64_08850) | - | 1862112..1865897 (-) | 3786 | WP_044557000.1 | phage tail spike protein | - |
| LRP64_RS08855 (LRP64_08855) | - | 1865913..1867397 (-) | 1485 | WP_044557002.1 | phage tail domain-containing protein | - |
| LRP64_RS08860 (LRP64_08860) | - | 1867394..1871938 (-) | 4545 | WP_113588360.1 | phage tail tape measure protein | - |
| LRP64_RS13755 | - | 1871995..1872129 (-) | 135 | WP_000364140.1 | hypothetical protein | - |
| LRP64_RS08865 (LRP64_08865) | - | 1872183..1872533 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| LRP64_RS08870 (LRP64_08870) | - | 1872583..1872813 (-) | 231 | Protein_1749 | Ig-like domain-containing protein | - |
| LRP64_RS08875 (LRP64_08875) | - | 1872849..1873493 (-) | 645 | WP_044557008.1 | major tail protein | - |
| LRP64_RS08880 (LRP64_08880) | - | 1873494..1873901 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| LRP64_RS08885 (LRP64_08885) | - | 1873898..1874302 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| LRP64_RS08890 (LRP64_08890) | - | 1874299..1874661 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| LRP64_RS08895 (LRP64_08895) | - | 1874645..1874929 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| LRP64_RS08900 (LRP64_08900) | - | 1874919..1875203 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| LRP64_RS08905 (LRP64_08905) | - | 1875223..1876368 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| LRP64_RS08910 (LRP64_08910) | - | 1876392..1877129 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| LRP64_RS08915 (LRP64_08915) | - | 1877113..1878300 (-) | 1188 | WP_113556760.1 | phage portal protein | - |
| LRP64_RS08920 (LRP64_08920) | - | 1878316..1879977 (-) | 1662 | WP_031901050.1 | terminase large subunit | - |
| LRP64_RS08925 (LRP64_08925) | - | 1879974..1880318 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| LRP64_RS08930 (LRP64_08930) | - | 1880448..1880747 (-) | 300 | WP_000988330.1 | HNH endonuclease | - |
| LRP64_RS08935 (LRP64_08935) | - | 1880979..1881395 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| LRP64_RS08940 (LRP64_08940) | - | 1881423..1881623 (-) | 201 | WP_000265043.1 | DUF1514 family protein | - |
| LRP64_RS08945 (LRP64_08945) | - | 1881623..1881772 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LRP64_RS08950 (LRP64_08950) | - | 1881769..1882155 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| LRP64_RS08955 (LRP64_08955) | - | 1882152..1882358 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| LRP64_RS08960 (LRP64_08960) | - | 1882355..1882600 (-) | 246 | WP_001282074.1 | hypothetical protein | - |
| LRP64_RS08965 (LRP64_08965) | - | 1882637..1883173 (-) | 537 | WP_000185680.1 | dUTPase | - |
| LRP64_RS08970 (LRP64_08970) | - | 1883166..1883414 (-) | 249 | WP_001065072.1 | DUF1024 family protein | - |
| LRP64_RS08975 (LRP64_08975) | - | 1883428..1883670 (-) | 243 | WP_000131384.1 | SAV1978 family virulence-associated passenger protein | - |
| LRP64_RS08980 (LRP64_08980) | - | 1883674..1884042 (-) | 369 | WP_000101275.1 | SA1788 family PVL leukocidin-associated protein | - |
| LRP64_RS08985 (LRP64_08985) | - | 1884055..1884510 (-) | 456 | WP_000401965.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LRP64_RS08990 (LRP64_08990) | - | 1884519..1884737 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| LRP64_RS08995 (LRP64_08995) | - | 1884744..1885637 (-) | 894 | WP_031770227.1 | DnaD domain-containing protein | - |
| LRP64_RS09000 (LRP64_09000) | ssbA | 1885667..1886137 (-) | 471 | WP_000934772.1 | single-stranded DNA-binding protein | Machinery gene |
| LRP64_RS09005 (LRP64_09005) | - | 1886138..1886755 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| LRP64_RS09010 (LRP64_09010) | - | 1886836..1887756 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| LRP64_RS09015 (LRP64_09015) | - | 1887758..1889701 (-) | 1944 | WP_044557032.1 | AAA family ATPase | - |
| LRP64_RS09020 (LRP64_09020) | - | 1889710..1889973 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| LRP64_RS09025 (LRP64_09025) | - | 1889982..1890242 (-) | 261 | WP_072456798.1 | DUF1108 family protein | - |
| LRP64_RS09030 (LRP64_09030) | - | 1890247..1890549 (-) | 303 | WP_044131919.1 | DUF2482 family protein | - |
| LRP64_RS09035 (LRP64_09035) | - | 1890641..1890802 (-) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| LRP64_RS09040 (LRP64_09040) | - | 1890799..1891119 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LRP64_RS09045 (LRP64_09045) | - | 1891178..1891810 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| LRP64_RS09050 (LRP64_09050) | - | 1891825..1891965 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| LRP64_RS09055 (LRP64_09055) | - | 1891996..1892193 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| LRP64_RS09060 (LRP64_09060) | - | 1892209..1892961 (-) | 753 | WP_113556758.1 | phage antirepressor KilAC domain-containing protein | - |
| LRP64_RS09065 (LRP64_09065) | - | 1893012..1893341 (+) | 330 | WP_000180411.1 | hypothetical protein | - |
| LRP64_RS09070 (LRP64_09070) | - | 1893330..1893545 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| LRP64_RS09075 (LRP64_09075) | - | 1893561..1893824 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| LRP64_RS09080 (LRP64_09080) | - | 1893821..1893994 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| LRP64_RS09085 (LRP64_09085) | - | 1893957..1894670 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| LRP64_RS09090 (LRP64_09090) | - | 1894686..1895618 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| LRP64_RS09095 (LRP64_09095) | - | 1895624..1895965 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| LRP64_RS09100 (LRP64_09100) | - | 1896169..1896351 (+) | 183 | WP_000705248.1 | hypothetical protein | - |
| LRP64_RS09105 (LRP64_09105) | - | 1896451..1896915 (+) | 465 | WP_000825947.1 | hypothetical protein | - |
| LRP64_RS09110 (LRP64_09110) | - | 1896974..1898011 (+) | 1038 | WP_000857191.1 | site-specific integrase | - |
| LRP64_RS09115 (LRP64_09115) | - | 1898239..1898523 (-) | 285 | WP_000134547.1 | hypothetical protein | - |
| LRP64_RS09120 (LRP64_09120) | - | 1898577..1898675 (-) | 99 | Protein_1799 | IS21-like element ISCbo2 family helper ATPase IstB | - |
| LRP64_RS09125 (LRP64_09125) | istA | 1898668..1899959 (-) | 1292 | Protein_1800 | IS21 family transposase | - |
| LRP64_RS09130 (LRP64_09130) | - | 1900050..1900316 (+) | 267 | Protein_1801 | hypothetical protein | - |
| LRP64_RS09135 (LRP64_09135) | - | 1900353..1901141 (+) | 789 | WP_000206347.1 | DUF1829 domain-containing protein | - |
| LRP64_RS09140 (LRP64_09140) | - | 1901602..1901812 (+) | 211 | Protein_1803 | hypothetical protein | - |
| LRP64_RS09185 (LRP64_09185) | - | 1903586..1904140 (-) | 555 | WP_000132890.1 | alpha/beta hydrolase | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17657.52 Da Isoelectric Point: 5.2672
>NTDB_id=633037 LRP64_RS09000 WP_000934772.1 1885667..1886137(-) (ssbA) [Staphylococcus aureus strain 697]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=633037 LRP64_RS09000 WP_000934772.1 1885667..1886137(-) (ssbA) [Staphylococcus aureus strain 697]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |