Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LOK81_RS03025 | Genome accession | NZ_CP087992 |
| Coordinates | 698492..698938 (-) | Length | 148 a.a. |
| NCBI ID | WP_021358633.1 | Uniprot ID | - |
| Organism | Xylella fastidiosa subsp. multiplex strain CFBP8433 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 691663..717882 | 698492..698938 | within | 0 |
Gene organization within MGE regions
Location: 691663..717882
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOK81_RS02985 (LOK81_02965) | - | 691663..692493 (-) | 831 | WP_004083974.1 | ABC transporter ATP-binding protein | - |
| LOK81_RS02990 (LOK81_02970) | - | 692499..693617 (-) | 1119 | WP_004083972.1 | ABC transporter permease | - |
| LOK81_RS02995 (LOK81_02975) | - | 693727..694989 (+) | 1263 | WP_012337721.1 | threonine/serine exporter family protein | - |
| LOK81_RS03000 (LOK81_02980) | - | 695630..695836 (+) | 207 | WP_071869858.1 | hypothetical protein | - |
| LOK81_RS03005 (LOK81_02985) | - | 695900..696112 (+) | 213 | WP_228304324.1 | hypothetical protein | - |
| LOK81_RS03010 (LOK81_02990) | - | 696176..696385 (+) | 210 | WP_225621843.1 | hypothetical protein | - |
| LOK81_RS03015 (LOK81_02995) | - | 697026..698198 (-) | 1173 | WP_004083967.1 | integrase | - |
| LOK81_RS03020 (LOK81_03000) | - | 698198..698470 (-) | 273 | WP_004083966.1 | hypothetical protein | - |
| LOK81_RS03025 (LOK81_03005) | ssb | 698492..698938 (-) | 447 | WP_021358633.1 | single-stranded DNA-binding protein | Machinery gene |
| LOK81_RS03030 (LOK81_03010) | - | 698922..699392 (-) | 471 | WP_076613218.1 | DUF5131 family protein | - |
| LOK81_RS03035 (LOK81_03015) | - | 699385..699615 (-) | 231 | WP_021358635.1 | hypothetical protein | - |
| LOK81_RS03040 (LOK81_03020) | - | 699615..700148 (-) | 534 | WP_004083962.1 | hypothetical protein | - |
| LOK81_RS03045 (LOK81_03025) | - | 700145..700738 (-) | 594 | WP_004083960.1 | DapH/DapD/GlmU-related protein | - |
| LOK81_RS03050 (LOK81_03030) | - | 700831..701364 (-) | 534 | WP_012337723.1 | pilin | - |
| LOK81_RS03055 (LOK81_03035) | - | 701497..701763 (-) | 267 | WP_004084112.1 | hypothetical protein | - |
| LOK81_RS03060 (LOK81_03040) | - | 701760..702038 (-) | 279 | WP_004083957.1 | hypothetical protein | - |
| LOK81_RS03065 (LOK81_03045) | - | 702035..702256 (-) | 222 | WP_021358638.1 | hypothetical protein | - |
| LOK81_RS03070 (LOK81_03050) | - | 702253..702711 (-) | 459 | WP_004084109.1 | hypothetical protein | - |
| LOK81_RS03075 (LOK81_03055) | - | 702708..703172 (-) | 465 | WP_021358639.1 | DUF1566 domain-containing protein | - |
| LOK81_RS03080 (LOK81_03060) | - | 703169..703702 (-) | 534 | WP_004084107.1 | hypothetical protein | - |
| LOK81_RS03085 (LOK81_03065) | - | 703656..704279 (+) | 624 | WP_004083954.1 | hypothetical protein | - |
| LOK81_RS03090 (LOK81_03070) | - | 704381..704782 (-) | 402 | WP_004084104.1 | hypothetical protein | - |
| LOK81_RS03095 (LOK81_03075) | - | 704781..705269 (+) | 489 | WP_238836475.1 | CHC2 zinc finger domain-containing protein | - |
| LOK81_RS03100 (LOK81_03080) | - | 705205..705849 (+) | 645 | WP_228762222.1 | terminase gpA endonuclease subunit | - |
| LOK81_RS03105 (LOK81_03085) | - | 705926..706162 (+) | 237 | WP_012337727.1 | hypothetical protein | - |
| LOK81_RS03110 (LOK81_03090) | - | 706159..706674 (+) | 516 | WP_004083947.1 | phage portal protein | - |
| LOK81_RS03115 (LOK81_03095) | - | 706839..707081 (+) | 243 | WP_228762223.1 | hypothetical protein | - |
| LOK81_RS11260 | - | 707095..707217 (+) | 123 | WP_324187556.1 | hypothetical protein | - |
| LOK81_RS03120 (LOK81_03100) | - | 707208..707636 (+) | 429 | WP_004083945.1 | hypothetical protein | - |
| LOK81_RS03125 (LOK81_03105) | - | 707633..707869 (+) | 237 | WP_004083943.1 | hypothetical protein | - |
| LOK81_RS03130 (LOK81_03110) | - | 707859..710684 (+) | 2826 | WP_169709956.1 | phage tail protein | - |
| LOK81_RS03135 (LOK81_03115) | - | 710677..711189 (+) | 513 | WP_169709957.1 | hypothetical protein | - |
| LOK81_RS03140 (LOK81_03120) | - | 711193..711612 (+) | 420 | WP_004083636.1 | hypothetical protein | - |
| LOK81_RS03145 (LOK81_03125) | - | 711721..712383 (+) | 663 | WP_228762226.1 | hypothetical protein | - |
| LOK81_RS03150 | - | 712443..712571 (-) | 129 | WP_256704593.1 | hypothetical protein | - |
| LOK81_RS03155 (LOK81_03130) | - | 712619..712726 (+) | 108 | Protein_602 | DNA adenine methylase | - |
| LOK81_RS03160 (LOK81_03135) | - | 712778..713404 (+) | 627 | WP_038230952.1 | IS607 family transposase | - |
| LOK81_RS03165 (LOK81_03140) | - | 713398..714594 (+) | 1197 | WP_004083925.1 | RNA-guided endonuclease TnpB family protein | - |
| LOK81_RS03170 (LOK81_03145) | - | 714601..715305 (+) | 705 | WP_154123795.1 | DNA adenine methylase | - |
| LOK81_RS03175 (LOK81_03150) | - | 715562..715960 (-) | 399 | WP_012337731.1 | hypothetical protein | - |
| LOK81_RS03180 (LOK81_03155) | - | 716011..716310 (-) | 300 | WP_004084250.1 | hypothetical protein | - |
| LOK81_RS03185 | - | 716444..716575 (-) | 132 | WP_256704532.1 | hypothetical protein | - |
| LOK81_RS03190 (LOK81_03160) | - | 716670..716912 (-) | 243 | WP_020851762.1 | hypothetical protein | - |
| LOK81_RS03195 (LOK81_03165) | - | 717318..717611 (-) | 294 | WP_234759377.1 | BrnA antitoxin family protein | - |
| LOK81_RS03200 (LOK81_03170) | - | 717595..717882 (-) | 288 | WP_004083921.1 | BrnT family toxin | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16536.38 Da Isoelectric Point: 6.4871
>NTDB_id=632126 LOK81_RS03025 WP_021358633.1 698492..698938(-) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8433]
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
MARGINKVILVGNLGNEPDIKYTQSGMTITSISLATSSGRKDREGNTQERTEWHRVKFFGKLGEIAAEYLHKGSQCYIEG
TIRYDKFTGQDGQERYVTEIIADQMHMLGGRGEGSSGITPQRQPAKVRNNDKAYAYAGDDFHDDDIPF
Nucleotide
Download Length: 447 bp
>NTDB_id=632126 LOK81_RS03025 WP_021358633.1 698492..698938(-) (ssb) [Xylella fastidiosa subsp. multiplex strain CFBP8433]
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
ATGGCACGCGGAATTAACAAGGTGATCCTAGTCGGCAACCTGGGGAACGAACCGGATATCAAATACACCCAAAGCGGCAT
GACGATCACCAGCATTAGCCTAGCGACCAGCAGCGGACGCAAGGACAGAGAGGGCAATACCCAGGAGCGGACCGAATGGC
ACCGCGTCAAGTTTTTCGGAAAGCTTGGCGAGATTGCCGCCGAATATCTGCATAAGGGATCGCAGTGCTACATAGAGGGC
ACCATCCGTTACGACAAGTTCACCGGCCAGGACGGTCAGGAGCGTTATGTCACTGAGATTATTGCTGACCAAATGCACAT
GCTCGGCGGTCGCGGTGAAGGCTCCAGCGGTATCACGCCACAGCGGCAACCGGCAAAGGTCCGTAACAACGATAAAGCCT
ATGCGTATGCAGGCGACGACTTCCACGATGACGACATCCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
41.477 |
100 |
0.493 |
| ssb | Neisseria meningitidis MC58 |
38.728 |
100 |
0.453 |
| ssb | Neisseria gonorrhoeae MS11 |
38.728 |
100 |
0.453 |
| ssb | Glaesserella parasuis strain SC1401 |
41.304 |
93.243 |
0.385 |