Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LO010_RS02945 Genome accession   NZ_CP087335
Coordinates   596396..596749 (-) Length   117 a.a.
NCBI ID   WP_002056028.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain DB053     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 594029..626081 596396..596749 within 0


Gene organization within MGE regions


Location: 594029..626081
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LO010_RS02925 - 594029..595096 (+) 1068 WP_000107854.1 site-specific integrase -
  LO010_RS02930 - 595125..595421 (-) 297 WP_033917269.1 hypothetical protein -
  LO010_RS02935 - 595418..595639 (-) 222 WP_033917270.1 hypothetical protein -
  LO010_RS02940 - 595649..596386 (-) 738 WP_033917271.1 3'-5' exonuclease -
  LO010_RS02945 ssb 596396..596749 (-) 354 WP_002056028.1 single-stranded DNA-binding protein Machinery gene
  LO010_RS02950 - 596737..597054 (-) 318 WP_016804024.1 hypothetical protein -
  LO010_RS02955 - 597047..597217 (-) 171 WP_171248432.1 hypothetical protein -
  LO010_RS02960 - 597207..597713 (-) 507 WP_033917272.1 hypothetical protein -
  LO010_RS02965 - 597717..598148 (-) 432 WP_004842315.1 DUF2528 family protein -
  LO010_RS02970 - 598215..598547 (-) 333 WP_033917273.1 hypothetical protein -
  LO010_RS02975 - 598544..601282 (-) 2739 WP_078204227.1 toprim domain-containing protein -
  LO010_RS02980 - 601376..601564 (-) 189 WP_001043170.1 hypothetical protein -
  LO010_RS02985 - 601657..601998 (+) 342 WP_258580379.1 helix-turn-helix transcriptional regulator -
  LO010_RS02990 - 602043..602258 (-) 216 WP_005136258.1 hypothetical protein -
  LO010_RS02995 - 602383..603198 (-) 816 WP_258580380.1 Rha family transcriptional regulator -
  LO010_RS03000 - 603306..603500 (-) 195 WP_258580381.1 hypothetical protein -
  LO010_RS03005 - 603813..604691 (+) 879 WP_258580382.1 BRCT domain-containing protein -
  LO010_RS03010 - 604691..604972 (+) 282 WP_258580383.1 hypothetical protein -
  LO010_RS03015 - 605287..605487 (-) 201 WP_258580384.1 TraR/DksA C4-type zinc finger protein -
  LO010_RS03020 - 605484..605723 (-) 240 WP_258580385.1 ogr/Delta-like zinc finger family protein -
  LO010_RS03025 - 605853..607166 (-) 1314 WP_258580386.1 contractile injection system protein, VgrG/Pvc8 family -
  LO010_RS03030 - 607167..607607 (-) 441 WP_000979754.1 phage tail protein -
  LO010_RS03035 - 607613..610063 (-) 2451 WP_258580387.1 phage tail tape measure protein -
  LO010_RS20835 - 610077..610214 (-) 138 WP_153310048.1 GpE family phage tail protein -
  LO010_RS03040 - 610217..610558 (-) 342 WP_001071617.1 phage tail assembly protein -
  LO010_RS03045 - 610624..611142 (-) 519 WP_001207611.1 phage major tail tube protein -
  LO010_RS03050 - 611155..612330 (-) 1176 WP_258580388.1 phage tail sheath protein -
  LO010_RS03055 - 612495..614555 (-) 2061 WP_258580389.1 phage tail protein -
  LO010_RS03060 - 614552..615175 (-) 624 WP_258580390.1 phage tail protein I -
  LO010_RS03065 - 615180..616079 (-) 900 WP_258580391.1 baseplate J/gp47 family protein -
  LO010_RS03070 - 616076..616423 (-) 348 WP_258580392.1 GPW/gp25 family protein -
  LO010_RS03075 - 616420..617046 (-) 627 WP_258580393.1 phage baseplate assembly protein V -
  LO010_RS03080 - 617119..617568 (-) 450 WP_258580394.1 phage virion morphogenesis protein -
  LO010_RS03085 - 617565..618092 (-) 528 WP_087933538.1 phage tail protein -
  LO010_RS03090 - 618089..618919 (-) 831 WP_258580395.1 N-acetylmuramidase family protein -
  LO010_RS03095 - 618916..619185 (-) 270 WP_000571491.1 phage holin family protein -
  LO010_RS03100 - 619182..619532 (-) 351 WP_001114936.1 putative holin -
  LO010_RS03105 - 619541..619753 (-) 213 WP_258580396.1 tail protein X -
  LO010_RS03110 - 619746..619979 (-) 234 WP_258580397.1 hypothetical protein -
  LO010_RS03115 - 619979..620431 (-) 453 WP_258580398.1 head completion/stabilization protein -
  LO010_RS03120 gpM 620535..621299 (-) 765 WP_258580399.1 phage terminase small subunit -
  LO010_RS03125 - 621308..622321 (-) 1014 WP_258580400.1 phage major capsid protein, P2 family -
  LO010_RS03130 - 622327..623130 (-) 804 WP_258580401.1 GPO family capsid scaffolding protein -
  LO010_RS03135 - 623289..625073 (+) 1785 WP_057069883.1 terminase large subunit domain-containing protein -
  LO010_RS03140 - 625074..626081 (+) 1008 WP_033917295.1 phage portal protein -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13331.12 Da        Isoelectric Point: 9.7939

>NTDB_id=628875 LO010_RS02945 WP_002056028.1 596396..596749(-) (ssb) [Acinetobacter baumannii strain DB053]
MRGINKVILVGMLGANPIPKQFQNGGSYAQFSIATSEKYQDKRTGDWIENTEWHRIVAHNRLGEIACQILKKGSKVYIEG
SLHTRKWTDQNNQERYVTEVRAITFQSLDSLPQANPV

Nucleotide


Download         Length: 354 bp        

>NTDB_id=628875 LO010_RS02945 WP_002056028.1 596396..596749(-) (ssb) [Acinetobacter baumannii strain DB053]
ATGCGCGGAATAAATAAAGTGATCTTGGTTGGAATGCTTGGTGCTAACCCAATTCCTAAACAATTTCAAAATGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACGCACTGGAGATTGGATTGAAAATACAGAGTGGC
ATCGGATTGTGGCTCACAATCGCCTAGGTGAAATTGCCTGTCAAATTCTCAAAAAGGGTTCAAAAGTTTATATCGAAGGC
TCATTACATACACGGAAATGGACTGATCAAAACAATCAAGAACGTTACGTAACTGAAGTTAGAGCCATTACATTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-106)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

55.455

94.017

0.521
  ssb Vibrio cholerae strain A1552

54.545

84.615

0.462
  ssb Neisseria gonorrhoeae MS11

42.857

89.744

0.385
  ssb Neisseria meningitidis MC58

42.857

89.744

0.385