Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   LO013_RS14445 Genome accession   NZ_CP087325
Coordinates   2965502..2965855 (-) Length   117 a.a.
NCBI ID   WP_004738307.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain OC073     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2958246..3002931 2965502..2965855 within 0


Gene organization within MGE regions


Location: 2958246..3002931
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LO013_RS14405 - 2958246..2959232 (-) 987 WP_000031355.1 DUF1852 domain-containing protein -
  LO013_RS14410 - 2959599..2960471 (-) 873 WP_004738320.1 LysR family transcriptional regulator -
  LO013_RS14415 - 2960727..2961335 (+) 609 WP_004738318.1 LysE family translocator -
  LO013_RS14420 - 2961437..2962462 (-) 1026 WP_081400949.1 fatty acid desaturase -
  LO013_RS14425 - 2962678..2963526 (+) 849 Protein_2813 AraC family transcriptional regulator -
  LO013_RS14435 - 2964029..2965189 (-) 1161 WP_004738311.1 tyrosine-type recombinase/integrase -
  LO013_RS14440 - 2965278..2965481 (-) 204 WP_004738309.1 hypothetical protein -
  LO013_RS14445 ssb 2965502..2965855 (-) 354 WP_004738307.1 single-stranded DNA-binding protein Machinery gene
  LO013_RS14450 - 2965843..2966160 (-) 318 WP_004738305.1 hypothetical protein -
  LO013_RS14455 - 2966153..2966506 (-) 354 WP_004738303.1 hypothetical protein -
  LO013_RS14460 - 2966510..2967028 (-) 519 WP_004738302.1 hypothetical protein -
  LO013_RS14465 - 2967096..2967698 (-) 603 WP_004738299.1 hypothetical protein -
  LO013_RS14470 - 2967715..2970441 (-) 2727 WP_004738296.1 toprim domain-containing protein -
  LO013_RS14475 - 2970451..2970621 (-) 171 WP_004738295.1 hypothetical protein -
  LO013_RS14480 - 2970636..2970875 (-) 240 WP_004738293.1 hypothetical protein -
  LO013_RS14485 - 2970878..2971078 (-) 201 WP_004738291.1 hypothetical protein -
  LO013_RS14490 - 2971162..2971512 (+) 351 WP_004738288.1 hypothetical protein -
  LO013_RS14495 - 2971509..2972087 (-) 579 WP_004738286.1 hypothetical protein -
  LO013_RS14500 - 2972084..2972407 (-) 324 WP_004738284.1 hypothetical protein -
  LO013_RS14505 - 2972823..2973830 (+) 1008 WP_004738282.1 WYL domain-containing protein -
  LO013_RS14510 - 2973862..2974215 (+) 354 WP_258578235.1 hypothetical protein -
  LO013_RS14515 - 2974212..2975081 (-) 870 WP_016653396.1 IS982-like element ISAcsp2 family transposase -
  LO013_RS14520 - 2975106..2975651 (+) 546 WP_258578237.1 hypothetical protein -
  LO013_RS14525 - 2975984..2976682 (-) 699 WP_258578239.1 acyltransferase -
  LO013_RS14530 - 2976663..2977217 (-) 555 WP_258578241.1 acyltransferase -
  LO013_RS14535 - 2977371..2977724 (-) 354 WP_004738279.1 hypothetical protein -
  LO013_RS14540 - 2977729..2978124 (-) 396 WP_004738278.1 hypothetical protein -
  LO013_RS14545 - 2978124..2978411 (-) 288 WP_004738277.1 ogr/Delta-like zinc finger family protein -
  LO013_RS19060 - 2978530..2978721 (+) 192 WP_079270046.1 Com family DNA-binding transcriptional regulator -
  LO013_RS14550 - 2978690..2979481 (+) 792 WP_004738276.1 DNA adenine methylase -
  LO013_RS14555 - 2979478..2980695 (-) 1218 WP_004738275.1 contractile injection system protein, VgrG/Pvc8 family -
  LO013_RS14560 - 2980699..2981118 (-) 420 WP_004738274.1 phage tail protein -
  LO013_RS14565 - 2981133..2984762 (-) 3630 WP_004738273.1 hypothetical protein -
  LO013_RS14570 - 2984759..2984908 (-) 150 WP_109104290.1 GpE family phage tail protein -
  LO013_RS14575 - 2984887..2985267 (-) 381 WP_196085662.1 phage tail assembly protein -
  LO013_RS14580 - 2985329..2985844 (-) 516 WP_196085661.1 phage major tail tube protein -
  LO013_RS14585 - 2985856..2987025 (-) 1170 WP_004738266.1 phage tail sheath protein -
  LO013_RS14590 - 2987134..2987631 (-) 498 WP_196085660.1 hypothetical protein -
  LO013_RS14595 - 2987633..2990632 (-) 3000 WP_218264719.1 phage tail protein -
  LO013_RS14600 - 2990633..2991169 (-) 537 WP_005112001.1 phage tail protein I -
  LO013_RS14605 - 2991169..2992062 (-) 894 WP_254231394.1 baseplate J/gp47 family protein -
  LO013_RS14610 - 2992083..2992439 (-) 357 WP_196085348.1 GPW/gp25 family protein -
  LO013_RS14615 - 2992436..2992990 (-) 555 WP_196085347.1 phage baseplate assembly protein V -
  LO013_RS14620 - 2993051..2993512 (-) 462 WP_032058820.1 phage virion morphogenesis protein -
  LO013_RS14625 - 2993516..2994046 (-) 531 WP_005112011.1 phage tail protein -
  LO013_RS14630 - 2994043..2994873 (-) 831 WP_156190991.1 N-acetylmuramidase family protein -
  LO013_RS14635 - 2994870..2995127 (-) 258 WP_004738245.1 phage holin family protein -
  LO013_RS14640 - 2995124..2995483 (-) 360 WP_004703727.1 putative holin -
  LO013_RS14645 - 2995486..2995695 (-) 210 WP_004703729.1 tail protein X -
  LO013_RS14650 - 2995692..2996141 (-) 450 WP_196085346.1 head completion/stabilization protein -
  LO013_RS14655 gpM 2996242..2997006 (-) 765 WP_196085345.1 phage terminase small subunit -
  LO013_RS14660 - 2997013..2998023 (-) 1011 WP_001247975.1 phage major capsid protein, P2 family -
  LO013_RS14665 - 2998059..2998919 (-) 861 WP_196085344.1 GPO family capsid scaffolding protein -
  LO013_RS14670 - 2999098..3000876 (+) 1779 WP_196085343.1 terminase large subunit domain-containing protein -
  LO013_RS14675 - 3000873..3001919 (+) 1047 WP_254231395.1 phage portal protein -
  LO013_RS14680 - 3001930..3002145 (+) 216 WP_227552920.1 hypothetical protein -
  LO013_RS14685 - 3002253..3002432 (+) 180 WP_000009390.1 type II toxin-antitoxin system HicA family toxin -
  LO013_RS14690 - 3002518..3002931 (+) 414 WP_032058837.1 antitoxin -

Sequence

Protein


Download         Length: 117 a.a.        Molecular weight: 13204.83 Da        Isoelectric Point: 9.8037

>NTDB_id=628745 LO013_RS14445 WP_004738307.1 2965502..2965855(-) (ssb) [Acinetobacter baumannii strain OC073]
MRGINKVILVGSLGANPITKHYPNGNTYVQFSIATSEKYQDKNTGEWIENTEWHRIIAYGRLGEVATQILKKGSKVYVEG
SLRTRQVTDQRGQQGYITEVRANTFQSLDSLPQANPY

Nucleotide


Download         Length: 354 bp        

>NTDB_id=628745 LO013_RS14445 WP_004738307.1 2965502..2965855(-) (ssb) [Acinetobacter baumannii strain OC073]
ATGCGCGGGATAAATAAAGTCATTCTTGTGGGAAGTTTAGGTGCAAATCCAATAACCAAACATTACCCGAACGGTAATAC
TTACGTTCAGTTTTCGATTGCTACTTCAGAAAAGTATCAAGATAAAAACACAGGTGAATGGATTGAGAATACGGAATGGC
ATCGAATTATTGCATACGGTCGATTAGGTGAGGTTGCCACTCAAATCTTAAAAAAAGGTTCAAAAGTTTATGTAGAGGGT
TCTTTACGAACAAGACAAGTTACCGACCAAAGAGGTCAGCAAGGTTATATAACCGAAGTAAGGGCAAACACCTTTCAGTC
TTTAGATAGCCTTCCGCAAGCAAACCCTTATTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-107)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

54.545

94.017

0.513
  ssb Vibrio cholerae strain A1552

54.545

84.615

0.462
  ssb Neisseria gonorrhoeae MS11

42.857

89.744

0.385
  ssb Neisseria meningitidis MC58

42.857

89.744

0.385