Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LO012_RS17700 | Genome accession | NZ_CP087317 |
| Coordinates | 3632960..3633313 (+) | Length | 117 a.a. |
| NCBI ID | WP_059262579.1 | Uniprot ID | - |
| Organism | Acinetobacter baumannii strain OC064 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3594019..3635679 | 3632960..3633313 | within | 0 |
Gene organization within MGE regions
Location: 3594019..3635679
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LO012_RS17475 | - | 3594019..3594786 (-) | 768 | WP_032059466.1 | glycosyltransferase family 2 protein | - |
| LO012_RS17480 | - | 3594783..3595538 (-) | 756 | WP_000989966.1 | polysaccharide deacetylase family protein | - |
| LO012_RS17485 | - | 3595535..3596563 (-) | 1029 | WP_032025844.1 | glycosyltransferase | - |
| LO012_RS17490 | - | 3596586..3597476 (-) | 891 | WP_000548427.1 | mitochondrial fission ELM1 family protein | - |
| LO012_RS17495 | - | 3597544..3598470 (-) | 927 | WP_001046506.1 | branched-chain amino acid transaminase | - |
| LO012_RS17500 | glnE | 3598495..3601245 (-) | 2751 | WP_000990839.1 | bifunctional [glutamate--ammonia ligase]-adenylyl-L-tyrosine phosphorylase/[glutamate--ammonia-ligase] adenylyltransferase | - |
| LO012_RS17505 | - | 3601314..3602582 (-) | 1269 | WP_000194110.1 | sensor histidine kinase KdpD | - |
| LO012_RS17510 | - | 3603900..3604898 (-) | 999 | WP_059262864.1 | phage portal protein | - |
| LO012_RS17515 | - | 3604898..3606706 (-) | 1809 | WP_171254512.1 | terminase large subunit domain-containing protein | - |
| LO012_RS17520 | - | 3606844..3607671 (+) | 828 | WP_059262862.1 | GPO family capsid scaffolding protein | - |
| LO012_RS17525 | - | 3607724..3608712 (+) | 989 | Protein_3426 | phage major capsid protein, P2 family | - |
| LO012_RS17530 | gpM | 3608723..3609424 (+) | 702 | WP_059262859.1 | phage terminase small subunit | - |
| LO012_RS17535 | - | 3609527..3609979 (+) | 453 | WP_059262857.1 | head completion/stabilization protein | - |
| LO012_RS17540 | - | 3609980..3610189 (+) | 210 | WP_059262855.1 | tail protein X | - |
| LO012_RS17545 | - | 3610198..3610548 (+) | 351 | WP_001114936.1 | putative holin | - |
| LO012_RS17550 | - | 3610545..3610814 (+) | 270 | WP_000571491.1 | phage holin family protein | - |
| LO012_RS17555 | - | 3610811..3611641 (+) | 831 | WP_059262853.1 | N-acetylmuramidase family protein | - |
| LO012_RS17560 | - | 3611638..3612165 (+) | 528 | WP_059262851.1 | phage tail protein | - |
| LO012_RS17565 | - | 3612162..3612611 (+) | 450 | WP_059262849.1 | phage virion morphogenesis protein | - |
| LO012_RS17570 | - | 3612684..3613310 (+) | 627 | WP_059262847.1 | phage baseplate assembly protein V | - |
| LO012_RS17575 | - | 3613307..3613654 (+) | 348 | WP_059262846.1 | GPW/gp25 family protein | - |
| LO012_RS17580 | - | 3613651..3614553 (+) | 903 | WP_059262844.1 | baseplate J/gp47 family protein | - |
| LO012_RS17585 | - | 3614553..3615161 (+) | 609 | WP_059262842.1 | phage tail protein I | - |
| LO012_RS17590 | - | 3615164..3617620 (+) | 2457 | WP_059262839.1 | phage tail protein | - |
| LO012_RS17595 | - | 3617726..3618901 (+) | 1176 | WP_059262837.1 | phage tail sheath protein | - |
| LO012_RS17600 | - | 3618914..3619432 (+) | 519 | WP_032013880.1 | phage major tail tube protein | - |
| LO012_RS17605 | - | 3619500..3619841 (+) | 342 | WP_059262834.1 | phage tail assembly protein | - |
| LO012_RS17610 | - | 3619877..3619981 (+) | 105 | WP_227504003.1 | GpE family phage tail protein | - |
| LO012_RS17615 | - | 3619995..3622535 (+) | 2541 | WP_059262832.1 | phage tail tape measure protein | - |
| LO012_RS17620 | - | 3622541..3622981 (+) | 441 | WP_000979754.1 | phage tail protein | - |
| LO012_RS17625 | - | 3622982..3624295 (+) | 1314 | WP_059262830.1 | contractile injection system protein, VgrG/Pvc8 family | - |
| LO012_RS17630 | - | 3624425..3624664 (+) | 240 | WP_000113724.1 | ogr/Delta-like zinc finger family protein | - |
| LO012_RS17635 | - | 3624661..3624861 (+) | 201 | WP_000130087.1 | TraR/DksA C4-type zinc finger protein | - |
| LO012_RS17640 | - | 3625172..3625918 (-) | 747 | WP_059262828.1 | hypothetical protein | - |
| LO012_RS17645 | - | 3625990..3626724 (-) | 735 | WP_000190074.1 | hypothetical protein | - |
| LO012_RS17650 | - | 3627039..3627233 (+) | 195 | WP_057097134.1 | hypothetical protein | - |
| LO012_RS17655 | - | 3627236..3627481 (+) | 246 | WP_000789360.1 | hypothetical protein | - |
| LO012_RS17660 | - | 3627582..3627797 (+) | 216 | WP_000556347.1 | hypothetical protein | - |
| LO012_RS17665 | - | 3627842..3628183 (-) | 342 | WP_000786717.1 | helix-turn-helix domain-containing protein | - |
| LO012_RS17670 | - | 3628276..3628467 (+) | 192 | WP_032040900.1 | hypothetical protein | - |
| LO012_RS17675 | - | 3628561..3631299 (+) | 2739 | WP_059262576.1 | toprim domain-containing protein | - |
| LO012_RS17680 | - | 3631296..3631631 (+) | 336 | WP_057097136.1 | hypothetical protein | - |
| LO012_RS17685 | - | 3631699..3632130 (+) | 432 | WP_001178667.1 | DUF2528 family protein | - |
| LO012_RS17690 | - | 3632133..3632651 (+) | 519 | WP_005136254.1 | hypothetical protein | - |
| LO012_RS17695 | - | 3632655..3632972 (+) | 318 | WP_000049862.1 | hypothetical protein | - |
| LO012_RS17700 | ssb | 3632960..3633313 (+) | 354 | WP_059262579.1 | single-stranded DNA-binding protein | Machinery gene |
| LO012_RS17705 | - | 3633323..3634060 (+) | 738 | WP_059262581.1 | 3'-5' exonuclease | - |
| LO012_RS17710 | - | 3634070..3634291 (+) | 222 | WP_059262583.1 | hypothetical protein | - |
| LO012_RS17715 | - | 3634288..3634584 (+) | 297 | WP_000218943.1 | hypothetical protein | - |
| LO012_RS17720 | - | 3634612..3635679 (-) | 1068 | WP_059262584.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 117 a.a. Molecular weight: 13290.99 Da Isoelectric Point: 9.4650
>NTDB_id=628664 LO012_RS17700 WP_059262579.1 3632960..3633313(+) (ssb) [Acinetobacter baumannii strain OC064]
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKQTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
MRGINKVILVGVLGANPIPKQFQNGGSYAQFSIATSEKYQDKQTGDWIENTEWHRIVAHNRLGEIACQFLKKGSKVYIEG
SLHTRKWTDQNNQDRYVTEVRAITFQSLDSLPQANPV
Nucleotide
Download Length: 354 bp
>NTDB_id=628664 LO012_RS17700 WP_059262579.1 3632960..3633313(+) (ssb) [Acinetobacter baumannii strain OC064]
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACAAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
ATGCGCGGAATAAACAAAGTGATATTGGTCGGTGTGCTTGGTGCCAATCCAATTCCTAAACAGTTTCAAAACGGTGGCTC
CTATGCTCAGTTTTCAATTGCCACTTCAGAAAAATACCAGGACAAACAAACTGGTGACTGGATTGAAAATACAGAGTGGC
ATCGTATTGTTGCCCACAACAGACTAGGAGAAATTGCCTGCCAATTTCTTAAAAAAGGTTCAAAAGTTTATATCGAAGGG
TCATTACATACACGGAAATGGACTGACCAAAACAATCAAGACCGTTACGTAACTGAAGTTAGAGCCATTACTTTTCAATC
GCTCGATAGCTTGCCACAAGCAAACCCGGTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
56.364 |
94.017 |
0.53 |
| ssb | Vibrio cholerae strain A1552 |
55.556 |
84.615 |
0.47 |
| ssb | Neisseria gonorrhoeae MS11 |
40.952 |
89.744 |
0.368 |
| ssb | Neisseria meningitidis MC58 |
40.952 |
89.744 |
0.368 |