Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   LJN47_RS00945 Genome accession   NZ_CP086760
Coordinates   201135..201248 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain 3192     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 196135..206248
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LJN47_RS00920 (LJN47_00920) - 196203..198422 (+) 2220 WP_229929872.1 AAA family ATPase -
  LJN47_RS00925 (LJN47_00925) panD 198412..198765 (+) 354 WP_229929873.1 aspartate 1-decarboxylase -
  LJN47_RS00930 (LJN47_00930) - 198768..199061 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  LJN47_RS00935 (LJN47_00935) - 199061..200056 (+) 996 WP_229930182.1 PDZ domain-containing protein -
  LJN47_RS00940 (LJN47_00940) comB6 200064..201119 (+) 1056 WP_229930183.1 P-type conjugative transfer protein TrbL Machinery gene
  LJN47_RS00945 (LJN47_00945) comB7 201135..201248 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  LJN47_RS00950 (LJN47_00950) comB8 201245..201982 (+) 738 WP_229929874.1 type IV secretion system protein Machinery gene
  LJN47_RS00955 (LJN47_00955) comB9 201982..202959 (+) 978 WP_229929875.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  LJN47_RS00960 (LJN47_00960) comB10 202952..204088 (+) 1137 WP_220946695.1 DNA type IV secretion system protein ComB10 Machinery gene
  LJN47_RS00965 (LJN47_00965) - 204159..205571 (+) 1413 WP_220946694.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=626278 LJN47_RS00945 WP_001217873.1 201135..201248(+) (comB7) [Helicobacter pylori strain 3192]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=626278 LJN47_RS00945 WP_001217873.1 201135..201248(+) (comB7) [Helicobacter pylori strain 3192]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1