Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LLZ98_RS14270 | Genome accession | NZ_CP086215 |
| Coordinates | 2860475..2860945 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain Patient 14 Isolate 02 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2843699..2865991 | 2860475..2860945 | within | 0 |
Gene organization within MGE regions
Location: 2843699..2865991
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLZ98_RS14140 (LLZ98_14145) | - | 2843699..2844922 (-) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| LLZ98_RS14145 (LLZ98_14150) | lukH | 2845358..2846413 (+) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| LLZ98_RS14150 (LLZ98_14155) | lukG | 2846435..2847451 (+) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| LLZ98_RS14155 (LLZ98_14160) | sph | 2847689..2848519 (-) | 831 | Protein_2756 | sphingomyelin phosphodiesterase | - |
| LLZ98_RS14160 (LLZ98_14165) | - | 2848570..2849607 (-) | 1038 | WP_000857200.1 | site-specific integrase | - |
| LLZ98_RS14165 (LLZ98_14170) | - | 2849798..2850511 (-) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LLZ98_RS14170 (LLZ98_14175) | - | 2850590..2850772 (-) | 183 | WP_000705245.1 | hypothetical protein | - |
| LLZ98_RS14175 (LLZ98_14180) | - | 2850843..2851028 (-) | 186 | WP_000109189.1 | hypothetical protein | - |
| LLZ98_RS14180 (LLZ98_14185) | - | 2851025..2851171 (-) | 147 | WP_000345949.1 | hypothetical protein | - |
| LLZ98_RS14185 (LLZ98_14190) | - | 2851245..2852099 (-) | 855 | WP_001557601.1 | HIRAN domain-containing protein | - |
| LLZ98_RS14190 (LLZ98_14195) | - | 2852111..2852827 (-) | 717 | WP_237442572.1 | LexA family transcriptional regulator | - |
| LLZ98_RS14195 (LLZ98_14200) | - | 2852991..2853233 (+) | 243 | WP_000639923.1 | DUF739 family protein | - |
| LLZ98_RS14200 (LLZ98_14205) | - | 2853246..2853689 (+) | 444 | WP_000435360.1 | hypothetical protein | - |
| LLZ98_RS14205 (LLZ98_14210) | - | 2853704..2853844 (+) | 141 | WP_000939495.1 | hypothetical protein | - |
| LLZ98_RS14210 (LLZ98_14215) | - | 2853837..2854046 (-) | 210 | WP_000772137.1 | hypothetical protein | - |
| LLZ98_RS14215 (LLZ98_14220) | - | 2854103..2854852 (+) | 750 | WP_001148338.1 | phage antirepressor KilAC domain-containing protein | - |
| LLZ98_RS14220 (LLZ98_14225) | - | 2854868..2855065 (+) | 198 | WP_001148862.1 | hypothetical protein | - |
| LLZ98_RS14225 (LLZ98_14230) | - | 2855052..2855432 (-) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| LLZ98_RS14230 (LLZ98_14235) | - | 2855487..2855810 (+) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| LLZ98_RS14235 (LLZ98_14240) | - | 2855807..2855968 (+) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| LLZ98_RS14240 (LLZ98_14245) | - | 2856063..2856365 (+) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| LLZ98_RS14245 (LLZ98_14250) | - | 2856370..2856630 (+) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| LLZ98_RS14250 (LLZ98_14255) | - | 2856639..2856902 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| LLZ98_RS14255 (LLZ98_14260) | - | 2856911..2858854 (+) | 1944 | WP_000700555.1 | AAA family ATPase | - |
| LLZ98_RS14260 (LLZ98_14265) | - | 2858856..2859776 (+) | 921 | WP_000180600.1 | recombinase RecT | - |
| LLZ98_RS14265 (LLZ98_14270) | - | 2859857..2860474 (+) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| LLZ98_RS14270 (LLZ98_14275) | ssbA | 2860475..2860945 (+) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| LLZ98_RS14275 (LLZ98_14280) | - | 2860975..2861868 (+) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| LLZ98_RS14280 (LLZ98_14285) | - | 2861875..2862093 (+) | 219 | WP_000338528.1 | hypothetical protein | - |
| LLZ98_RS14285 (LLZ98_14290) | - | 2862102..2862506 (+) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLZ98_RS14290 (LLZ98_14295) | - | 2862519..2862890 (+) | 372 | WP_000101279.1 | SA1788 family PVL leukocidin-associated protein | - |
| LLZ98_RS14295 (LLZ98_14300) | - | 2862890..2863147 (+) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| LLZ98_RS14300 (LLZ98_14305) | - | 2863144..2863392 (+) | 249 | WP_000178987.1 | SAV1978 family virulence-associated passenger protein | - |
| LLZ98_RS14305 (LLZ98_14310) | - | 2863407..2863652 (+) | 246 | WP_001065108.1 | DUF1024 family protein | - |
| LLZ98_RS14310 (LLZ98_14315) | - | 2863649..2864185 (+) | 537 | WP_000185693.1 | dUTPase | - |
| LLZ98_RS14315 (LLZ98_14320) | - | 2864222..2864467 (+) | 246 | WP_001282077.1 | hypothetical protein | - |
| LLZ98_RS14320 (LLZ98_14325) | - | 2864464..2864670 (+) | 207 | WP_000195784.1 | DUF1381 domain-containing protein | - |
| LLZ98_RS14325 (LLZ98_14330) | - | 2864667..2864816 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| LLZ98_RS14330 (LLZ98_14335) | - | 2864816..2865016 (+) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| LLZ98_RS14335 (LLZ98_14340) | - | 2865044..2865460 (+) | 417 | WP_000590122.1 | hypothetical protein | - |
| LLZ98_RS14340 (LLZ98_14345) | - | 2865692..2865991 (+) | 300 | WP_000988332.1 | HNH endonuclease | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=623825 LLZ98_RS14270 WP_000934759.1 2860475..2860945(+) (ssbA) [Staphylococcus aureus strain Patient 14 Isolate 02]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=623825 LLZ98_RS14270 WP_000934759.1 2860475..2860945(+) (ssbA) [Staphylococcus aureus strain Patient 14 Isolate 02]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |