Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LLZ98_RS05120 | Genome accession | NZ_CP086215 |
| Coordinates | 1000252..1000722 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus strain Patient 14 Isolate 02 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 968191..1010752 | 1000252..1000722 | within | 0 |
Gene organization within MGE regions
Location: 968191..1010752
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLZ98_RS04885 (LLZ98_04890) | - | 968191..968376 (-) | 186 | WP_001286805.1 | hypothetical protein | - |
| LLZ98_RS04890 (LLZ98_04895) | - | 968378..968488 (-) | 111 | WP_000139423.1 | hypothetical protein | - |
| LLZ98_RS04895 (LLZ98_04900) | - | 968559..968711 (-) | 153 | WP_001788502.1 | hypothetical protein | - |
| LLZ98_RS04900 (LLZ98_04905) | - | 969086..969643 (+) | 558 | WP_001035620.1 | DUF4888 domain-containing protein | - |
| LLZ98_RS04905 (LLZ98_04910) | - | 969703..971115 (-) | 1413 | WP_001141517.1 | N-acetylmuramoyl-L-alanine amidase | - |
| LLZ98_RS04910 (LLZ98_04915) | - | 971102..971377 (-) | 276 | WP_000351119.1 | phage holin | - |
| LLZ98_RS04915 (LLZ98_04920) | - | 971433..971828 (-) | 396 | WP_000398878.1 | hypothetical protein | - |
| LLZ98_RS04920 (LLZ98_04925) | - | 971834..973072 (-) | 1239 | WP_001624558.1 | BppU family phage baseplate upper protein | - |
| LLZ98_RS04925 (LLZ98_04930) | - | 973085..974983 (-) | 1899 | WP_237442576.1 | glucosaminidase domain-containing protein | - |
| LLZ98_RS04930 (LLZ98_04935) | - | 975120..975419 (-) | 300 | WP_000466778.1 | DUF2951 domain-containing protein | - |
| LLZ98_RS04935 (LLZ98_04940) | - | 975460..975633 (-) | 174 | WP_015990323.1 | XkdX family protein | - |
| LLZ98_RS04940 (LLZ98_04945) | - | 975643..976020 (-) | 378 | WP_000705910.1 | DUF2977 domain-containing protein | - |
| LLZ98_RS04945 (LLZ98_04950) | - | 976020..977843 (-) | 1824 | WP_000259619.1 | BppU family phage baseplate upper protein | - |
| LLZ98_RS04950 (LLZ98_04955) | - | 977843..979753 (-) | 1911 | WP_000369017.1 | hypothetical protein | - |
| LLZ98_RS04955 (LLZ98_04960) | - | 979768..981669 (-) | 1902 | WP_000152714.1 | SGNH/GDSL hydrolase family protein | - |
| LLZ98_RS04960 (LLZ98_04965) | - | 981678..982625 (-) | 948 | WP_000350675.1 | phage tail family protein | - |
| LLZ98_RS04965 (LLZ98_04970) | - | 982638..986102 (-) | 3465 | WP_196506016.1 | hypothetical protein | - |
| LLZ98_RS04970 (LLZ98_04975) | - | 986119..986463 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| LLZ98_RS04975 (LLZ98_04980) | - | 986493..986858 (-) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| LLZ98_RS04980 (LLZ98_04985) | - | 986920..987501 (-) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| LLZ98_RS04985 (LLZ98_04990) | - | 987520..987903 (-) | 384 | WP_000188643.1 | hypothetical protein | - |
| LLZ98_RS04990 (LLZ98_04995) | - | 987915..988262 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LLZ98_RS04995 (LLZ98_05000) | - | 988262..988564 (-) | 303 | WP_001268312.1 | hypothetical protein | - |
| LLZ98_RS05000 (LLZ98_05005) | - | 988561..988893 (-) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| LLZ98_RS05005 (LLZ98_05010) | - | 988902..989189 (-) | 288 | WP_001114086.1 | hypothetical protein | - |
| LLZ98_RS05010 (LLZ98_05015) | - | 989211..990185 (-) | 975 | WP_000438511.1 | phage major capsid protein | - |
| LLZ98_RS05015 (LLZ98_05020) | - | 990199..990819 (-) | 621 | WP_000392151.1 | DUF4355 domain-containing protein | - |
| LLZ98_RS05020 (LLZ98_05025) | - | 990807..990900 (-) | 94 | Protein_964 | hypothetical protein | - |
| LLZ98_RS05025 (LLZ98_05030) | - | 990928..991098 (-) | 171 | WP_000072208.1 | hypothetical protein | - |
| LLZ98_RS05030 (LLZ98_05035) | - | 991171..992166 (-) | 996 | WP_001133044.1 | minor capsid protein | - |
| LLZ98_RS05035 (LLZ98_05040) | - | 992173..993711 (-) | 1539 | WP_001609086.1 | phage portal protein | - |
| LLZ98_RS05040 (LLZ98_05045) | - | 993722..994999 (-) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| LLZ98_RS05045 (LLZ98_05050) | - | 994986..995426 (-) | 441 | WP_001566315.1 | terminase small subunit | - |
| LLZ98_RS05050 (LLZ98_05055) | - | 995613..996032 (-) | 420 | WP_000058632.1 | transcriptional regulator | - |
| LLZ98_RS05055 (LLZ98_05060) | - | 996047..996193 (-) | 147 | WP_000990007.1 | hypothetical protein | - |
| LLZ98_RS05060 (LLZ98_05065) | - | 996194..996367 (-) | 174 | WP_025174872.1 | transcriptional activator RinB | - |
| LLZ98_RS05065 (LLZ98_05070) | - | 996370..996570 (-) | 201 | WP_001125015.1 | hypothetical protein | - |
| LLZ98_RS05070 (LLZ98_05075) | - | 996545..996733 (-) | 189 | WP_000195782.1 | DUF1381 domain-containing protein | - |
| LLZ98_RS05075 (LLZ98_05080) | - | 996730..996975 (-) | 246 | WP_001282077.1 | hypothetical protein | - |
| LLZ98_RS05080 (LLZ98_05085) | - | 997012..997548 (-) | 537 | WP_000185693.1 | dUTPase | - |
| LLZ98_RS05085 (LLZ98_05090) | - | 997545..997790 (-) | 246 | WP_001065108.1 | DUF1024 family protein | - |
| LLZ98_RS05090 (LLZ98_05095) | - | 997805..998053 (-) | 249 | WP_000178987.1 | SAV1978 family virulence-associated passenger protein | - |
| LLZ98_RS05095 (LLZ98_05100) | - | 998050..998307 (-) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| LLZ98_RS05100 (LLZ98_05105) | - | 998307..998678 (-) | 372 | WP_000101279.1 | SA1788 family PVL leukocidin-associated protein | - |
| LLZ98_RS05105 (LLZ98_05110) | - | 998691..999095 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLZ98_RS05110 (LLZ98_05115) | - | 999104..999322 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| LLZ98_RS05115 (LLZ98_05120) | - | 999329..1000222 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| LLZ98_RS05120 (LLZ98_05125) | ssbA | 1000252..1000722 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| LLZ98_RS05125 (LLZ98_05130) | - | 1000723..1001340 (-) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| LLZ98_RS05130 (LLZ98_05135) | - | 1001421..1002341 (-) | 921 | WP_000138475.1 | recombinase RecT | - |
| LLZ98_RS05135 (LLZ98_05140) | - | 1002343..1004298 (-) | 1956 | WP_049873509.1 | AAA family ATPase | - |
| LLZ98_RS05140 (LLZ98_05145) | - | 1004295..1004558 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| LLZ98_RS05145 (LLZ98_05150) | - | 1004567..1004827 (-) | 261 | WP_000291090.1 | DUF1108 family protein | - |
| LLZ98_RS05150 (LLZ98_05155) | - | 1004921..1005082 (-) | 162 | WP_000066026.1 | DUF1270 family protein | - |
| LLZ98_RS05155 (LLZ98_05160) | - | 1005262..1005492 (+) | 231 | WP_000395457.1 | hypothetical protein | - |
| LLZ98_RS05160 (LLZ98_05165) | - | 1005467..1005643 (-) | 177 | WP_001094935.1 | hypothetical protein | - |
| LLZ98_RS05165 (LLZ98_05170) | - | 1005696..1005890 (-) | 195 | WP_000390105.1 | hypothetical protein | - |
| LLZ98_RS05170 (LLZ98_05175) | - | 1005907..1006695 (-) | 789 | WP_001148566.1 | phage antirepressor KilAC domain-containing protein | - |
| LLZ98_RS05175 (LLZ98_05180) | - | 1006711..1006929 (-) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| LLZ98_RS05180 (LLZ98_05185) | - | 1007071..1007790 (+) | 720 | WP_000358224.1 | XRE family transcriptional regulator | - |
| LLZ98_RS05185 (LLZ98_05190) | - | 1007860..1008027 (+) | 168 | WP_000705238.1 | hypothetical protein | - |
| LLZ98_RS05190 (LLZ98_05195) | - | 1008167..1009099 (+) | 933 | WP_000392183.1 | hypothetical protein | - |
| LLZ98_RS05195 (LLZ98_05200) | - | 1009079..1009258 (-) | 180 | WP_000337827.1 | hypothetical protein | - |
| LLZ98_RS05200 (LLZ98_05205) | - | 1009367..1010752 (+) | 1386 | WP_000861313.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=623804 LLZ98_RS05120 WP_000934759.1 1000252..1000722(-) (ssbA) [Staphylococcus aureus strain Patient 14 Isolate 02]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=623804 LLZ98_RS05120 WP_000934759.1 1000252..1000722(-) (ssbA) [Staphylococcus aureus strain Patient 14 Isolate 02]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |