Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   LK685_RS04910 Genome accession   NZ_CP086061
Coordinates   968312..968479 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus sp. BC1-43     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 963312..973479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LK685_RS04880 (LK685_04885) - 963457..964929 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  LK685_RS04885 (LK685_04890) pdeH 965066..966295 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  LK685_RS04890 (LK685_04895) - 966271..966639 (-) 369 WP_003243784.1 hypothetical protein -
  LK685_RS04895 (LK685_04900) - 966753..966878 (-) 126 WP_003228793.1 hypothetical protein -
  LK685_RS04900 (LK685_04905) degQ 967100..967240 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  LK685_RS04905 (LK685_04910) comQ 967425..968324 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  LK685_RS04910 (LK685_04915) comX 968312..968479 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  LK685_RS04915 (LK685_04920) comP 968494..970803 (+) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  LK685_RS04920 (LK685_04925) comA 970884..971528 (+) 645 WP_229762681.1 two-component system response regulator ComA Regulator
  LK685_RS04925 (LK685_04930) - 971547..971927 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  LK685_RS04930 (LK685_04935) mnhG 971966..972340 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  LK685_RS04935 (LK685_04940) - 972324..972608 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  LK685_RS04940 (LK685_04945) - 972608..973084 (-) 477 WP_003228815.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=622156 LK685_RS04910 WP_003242801.1 968312..968479(+) (comX) [Bacillus sp. BC1-43]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=622156 LK685_RS04910 WP_003242801.1 968312..968479(+) (comX) [Bacillus sp. BC1-43]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1