Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   LK685_RS04900 Genome accession   NZ_CP086061
Coordinates   967100..967240 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus sp. BC1-43     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 962100..972240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LK685_RS04870 (LK685_04875) - 962395..962793 (+) 399 WP_003242987.1 YueI family protein -
  LK685_RS04875 (LK685_04880) - 962890..963441 (+) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  LK685_RS04880 (LK685_04885) - 963457..964929 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  LK685_RS04885 (LK685_04890) pdeH 965066..966295 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  LK685_RS04890 (LK685_04895) - 966271..966639 (-) 369 WP_003243784.1 hypothetical protein -
  LK685_RS04895 (LK685_04900) - 966753..966878 (-) 126 WP_003228793.1 hypothetical protein -
  LK685_RS04900 (LK685_04905) degQ 967100..967240 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  LK685_RS04905 (LK685_04910) comQ 967425..968324 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  LK685_RS04910 (LK685_04915) comX 968312..968479 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  LK685_RS04915 (LK685_04920) comP 968494..970803 (+) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  LK685_RS04920 (LK685_04925) comA 970884..971528 (+) 645 WP_229762681.1 two-component system response regulator ComA Regulator
  LK685_RS04925 (LK685_04930) - 971547..971927 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=622154 LK685_RS04900 WP_003220708.1 967100..967240(+) (degQ) [Bacillus sp. BC1-43]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=622154 LK685_RS04900 WP_003220708.1 967100..967240(+) (degQ) [Bacillus sp. BC1-43]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1