Detailed information NTG0617083

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: NUU05_RS01665
• Genome accession: NZ_CP102538
• Coordinates: 297313..297630 (+)
• Length: 105 a.a.
• NCBI ID: WP_011681685.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain TH-4
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 292313..302630

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NUU05_RS01630 (NUU05_01620)	-	293572..293934 (+)	363	WP_011226630.1	DUF1033 family protein	-
NUU05_RS01635 (NUU05_01625)	comGA/cglA/cilD	294015..294956 (+)	942	WP_011681689.1	competence type IV pilus ATPase ComGA	Machinery gene
NUU05_RS01640 (NUU05_01630)	comGB	294838..295938 (+)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
NUU05_RS01645 (NUU05_01635)	comGC	295935..296261 (+)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
NUU05_RS01650 (NUU05_01640)	comGD	296221..296649 (+)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
NUU05_RS01655 (NUU05_01645)	comGE	296621..296914 (+)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
NUU05_RS01660 (NUU05_01650)	comGF	296898..297335 (+)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
NUU05_RS01665 (NUU05_01655)	comGG	297313..297630 (+)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	Machinery gene
NUU05_RS01670 (NUU05_01660)	comGH	297675..298631 (+)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
NUU05_RS01675 (NUU05_01665)	-	298687..299880 (+)	1194	WP_014608740.1	acetate kinase	-
NUU05_RS01680 (NUU05_01670)	-	300129..300326 (+)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
NUU05_RS01685 (NUU05_01675)	-	300338..300613 (+)	276	WP_011681681.1	hypothetical protein	-
NUU05_RS01690 (NUU05_01680)	-	300657..300995 (+)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
NUU05_RS01695 (NUU05_01685)	-	301069..301512 (+)	444	WP_011681680.1	hypothetical protein	-
NUU05_RS01700 (NUU05_01690)	-	301609..302271 (+)	663	WP_011681679.1	CPBP family intramembrane glutamic endopeptidase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11851.01 Da
• Isoelectric Point: 10.6334

>NTDB_id=617083 NUU05_RS01665 WP_011681685.1 297313..297630(+) (comGG) [Streptococcus thermophilus strain TH-4]
MLLKKQVRGGVLLYALFMAGIFILLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVVVRVVSKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=617083 NUU05_RS01665 WP_011681685.1 297313..297630(+) (comGG) [Streptococcus thermophilus strain TH-4]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTATACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGGTTGTCAGAGTTGTCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae TIGR4	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae D39	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae R6	43.333	85.714	0.371
comGG/cglG	Streptococcus mitis NCTC 12261	42.222	85.714	0.362