Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | RBAU_RS15345 | Genome accession | NC_022075 |
| Coordinates | 3148739..3148879 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus velezensis UCMB5033 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3143739..3153879
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RBAU_RS15320 (RBAU_3005) | - | 3144035..3144418 (-) | 384 | WP_007408674.1 | hotdog fold thioesterase | - |
| RBAU_RS15325 (RBAU_3006) | comA | 3144440..3145084 (-) | 645 | WP_003152052.1 | response regulator transcription factor | Regulator |
| RBAU_RS15330 (RBAU_3007) | comP | 3145165..3147474 (-) | 2310 | WP_020954299.1 | histidine kinase | Regulator |
| RBAU_RS15335 (RBAU_3008) | comX | 3147494..3147670 (-) | 177 | WP_007408675.1 | competence pheromone ComX | - |
| RBAU_RS15340 (RBAU_3009) | comQ | 3147670..3148608 (-) | 939 | WP_020954300.1 | polyprenyl synthetase family protein | Regulator |
| RBAU_RS15345 (RBAU_3010) | degQ | 3148739..3148879 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| RBAU_RS15350 (RBAU_3011) | - | 3149345..3149686 (+) | 342 | WP_007408677.1 | hypothetical protein | - |
| RBAU_RS15355 (RBAU_3012) | - | 3149693..3150916 (-) | 1224 | WP_007408678.1 | EAL and HDOD domain-containing protein | - |
| RBAU_RS15360 (RBAU_3013) | - | 3151046..3152512 (-) | 1467 | WP_020954301.1 | nicotinate phosphoribosyltransferase | - |
| RBAU_RS15365 (RBAU_3014) | - | 3152530..3153081 (-) | 552 | WP_003152033.1 | isochorismatase family cysteine hydrolase | - |
| RBAU_RS15370 (RBAU_3015) | - | 3153178..3153576 (-) | 399 | WP_003152031.1 | DUF1694 domain-containing protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=61009 RBAU_RS15345 WP_003152043.1 3148739..3148879(-) (degQ) [Bacillus velezensis UCMB5033]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=61009 RBAU_RS15345 WP_003152043.1 3148739..3148879(-) (degQ) [Bacillus velezensis UCMB5033]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |