Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   RBAU_RS15345 Genome accession   NC_022075
Coordinates   3148739..3148879 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis UCMB5033     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3143739..3153879
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  RBAU_RS15320 (RBAU_3005) - 3144035..3144418 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  RBAU_RS15325 (RBAU_3006) comA 3144440..3145084 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  RBAU_RS15330 (RBAU_3007) comP 3145165..3147474 (-) 2310 WP_020954299.1 histidine kinase Regulator
  RBAU_RS15335 (RBAU_3008) comX 3147494..3147670 (-) 177 WP_007408675.1 competence pheromone ComX -
  RBAU_RS15340 (RBAU_3009) comQ 3147670..3148608 (-) 939 WP_020954300.1 polyprenyl synthetase family protein Regulator
  RBAU_RS15345 (RBAU_3010) degQ 3148739..3148879 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  RBAU_RS15350 (RBAU_3011) - 3149345..3149686 (+) 342 WP_007408677.1 hypothetical protein -
  RBAU_RS15355 (RBAU_3012) - 3149693..3150916 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  RBAU_RS15360 (RBAU_3013) - 3151046..3152512 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  RBAU_RS15365 (RBAU_3014) - 3152530..3153081 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  RBAU_RS15370 (RBAU_3015) - 3153178..3153576 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=61009 RBAU_RS15345 WP_003152043.1 3148739..3148879(-) (degQ) [Bacillus velezensis UCMB5033]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=61009 RBAU_RS15345 WP_003152043.1 3148739..3148879(-) (degQ) [Bacillus velezensis UCMB5033]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCTATGAAAATTTCTTAA

Domains


Predicted by InterproScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891


Multiple sequence alignment