Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LB317_RS09655 | Genome accession | NZ_CP083805 |
| Coordinates | 2023943..2024413 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934772.1 | Uniprot ID | - |
| Organism | Staphylococcus argenteus strain 1801221 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1994465..2048370 | 2023943..2024413 | within | 0 |
Gene organization within MGE regions
Location: 1994465..2048370
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LB317_RS09440 (LB317_09450) | scn | 1994465..1994815 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| LB317_RS09445 (LB317_09455) | - | 1995326..1995664 (-) | 339 | Protein_1826 | SH3 domain-containing protein | - |
| LB317_RS09450 (LB317_09460) | sak | 1996312..1996803 (-) | 492 | WP_000920035.1 | staphylokinase | - |
| LB317_RS09455 (LB317_09465) | - | 1996994..1997749 (-) | 756 | WP_000861030.1 | CHAP domain-containing protein | - |
| LB317_RS09460 (LB317_09470) | - | 1997761..1998015 (-) | 255 | WP_000611512.1 | phage holin | - |
| LB317_RS09465 (LB317_09475) | - | 1998067..1998174 (+) | 108 | WP_001791821.1 | hypothetical protein | - |
| LB317_RS09470 (LB317_09480) | pepG1 | 1998227..1998361 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| LB317_RS09475 (LB317_09485) | - | 1998553..1998849 (-) | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| LB317_RS09480 (LB317_09490) | - | 1998907..1999194 (-) | 288 | WP_001040256.1 | hypothetical protein | - |
| LB317_RS09485 (LB317_09495) | - | 1999241..1999393 (-) | 153 | WP_001153681.1 | hypothetical protein | - |
| LB317_RS09490 (LB317_09500) | - | 1999383..2003168 (-) | 3786 | WP_031788239.1 | phage tail spike protein | - |
| LB317_RS09495 (LB317_09505) | - | 2003184..2004668 (-) | 1485 | WP_000567390.1 | phage distal tail protein | - |
| LB317_RS09500 (LB317_09510) | - | 2004665..2009194 (-) | 4530 | WP_031788240.1 | phage tail tape measure protein | - |
| LB317_RS09505 (LB317_09515) | gpGT | 2009251..2009388 (-) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| LB317_RS09510 (LB317_09520) | gpG | 2009439..2009789 (-) | 351 | WP_239794156.1 | phage tail assembly chaperone G | - |
| LB317_RS09515 (LB317_09525) | - | 2009839..2010063 (-) | 225 | WP_072050172.1 | Ig-like domain-containing protein | - |
| LB317_RS09520 (LB317_09530) | - | 2010105..2010749 (-) | 645 | WP_000268732.1 | major tail protein | - |
| LB317_RS09525 (LB317_09535) | - | 2010750..2011157 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| LB317_RS09530 (LB317_09540) | - | 2011154..2011558 (-) | 405 | WP_031788241.1 | HK97 gp10 family phage protein | - |
| LB317_RS09535 (LB317_09545) | - | 2011555..2011917 (-) | 363 | WP_001231000.1 | phage head completion protein | - |
| LB317_RS09540 (LB317_09550) | - | 2011901..2012182 (-) | 282 | WP_000344038.1 | phage head-tail adapter protein | - |
| LB317_RS09545 (LB317_09555) | - | 2012191..2012469 (-) | 279 | WP_000005716.1 | hypothetical protein | - |
| LB317_RS09550 (LB317_09560) | - | 2012488..2013627 (-) | 1140 | WP_000216654.1 | phage major capsid protein | - |
| LB317_RS09555 (LB317_09565) | - | 2013651..2014373 (-) | 723 | WP_000700968.1 | head maturation protease, ClpP-related | - |
| LB317_RS09560 (LB317_09570) | - | 2014370..2015518 (-) | 1149 | WP_000511812.1 | phage portal protein | - |
| LB317_RS09565 (LB317_09575) | - | 2015533..2017194 (-) | 1662 | WP_000625099.1 | terminase large subunit | - |
| LB317_RS09570 (LB317_09580) | - | 2017191..2017535 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| LB317_RS09575 (LB317_09585) | - | 2017665..2017964 (-) | 300 | WP_000988336.1 | HNH endonuclease | - |
| LB317_RS09580 (LB317_09590) | - | 2018196..2018612 (-) | 417 | WP_000590126.1 | hypothetical protein | - |
| LB317_RS09585 (LB317_09595) | - | 2018640..2018840 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| LB317_RS09590 (LB317_09600) | rinB | 2018840..2018989 (-) | 150 | WP_000237868.1 | transcriptional activator RinB | - |
| LB317_RS09595 (LB317_09605) | - | 2018992..2019192 (-) | 201 | WP_001125015.1 | hypothetical protein | - |
| LB317_RS09600 (LB317_09610) | - | 2019167..2019355 (-) | 189 | WP_000195837.1 | DUF1381 domain-containing protein | - |
| LB317_RS09605 (LB317_09615) | - | 2019392..2019934 (-) | 543 | WP_000181814.1 | dUTP diphosphatase | - |
| LB317_RS09610 (LB317_09620) | - | 2020290..2020415 (-) | 126 | Protein_1859 | DUF1024 family protein | - |
| LB317_RS09615 (LB317_09625) | - | 2020408..2020818 (-) | 411 | WP_000197966.1 | hypothetical protein | - |
| LB317_RS09620 (LB317_09630) | - | 2020977..2021324 (-) | 348 | WP_001105606.1 | hypothetical protein | - |
| LB317_RS09625 (LB317_09635) | - | 2021321..2021758 (-) | 438 | WP_014373867.1 | YopX family protein | - |
| LB317_RS09630 (LB317_09640) | - | 2021769..2022017 (-) | 249 | WP_001126845.1 | phi PVL orf 51-like protein | - |
| LB317_RS09635 (LB317_09645) | - | 2022018..2022369 (-) | 352 | Protein_1864 | SA1788 family PVL leukocidin-associated protein | - |
| LB317_RS09640 (LB317_09650) | - | 2022382..2022786 (-) | 405 | WP_000401958.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LB317_RS09645 (LB317_09655) | - | 2022795..2023013 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| LB317_RS09650 (LB317_09660) | - | 2023020..2023913 (-) | 894 | WP_000148334.1 | DnaD domain protein | - |
| LB317_RS09655 (LB317_09665) | ssbA | 2023943..2024413 (-) | 471 | WP_000934772.1 | single-stranded DNA-binding protein | Machinery gene |
| LB317_RS09660 (LB317_09670) | - | 2024414..2025031 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| LB317_RS09665 (LB317_09675) | - | 2025112..2026032 (-) | 921 | WP_000138479.1 | recombinase RecT | - |
| LB317_RS09670 (LB317_09680) | - | 2026034..2027989 (-) | 1956 | WP_048657537.1 | AAA family ATPase | - |
| LB317_RS09675 (LB317_09685) | - | 2027986..2028249 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| LB317_RS09680 (LB317_09690) | - | 2028258..2028518 (-) | 261 | WP_000291505.1 | DUF1108 family protein | - |
| LB317_RS09685 (LB317_09695) | - | 2028558..2028818 (-) | 261 | WP_001817285.1 | DUF2482 family protein | - |
| LB317_RS09690 (LB317_09700) | - | 2028913..2029074 (-) | 162 | WP_000066009.1 | DUF1270 domain-containing protein | - |
| LB317_RS09695 (LB317_09705) | - | 2029071..2029391 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| LB317_RS09700 (LB317_09710) | - | 2029450..2030082 (+) | 633 | WP_031787846.1 | hypothetical protein | - |
| LB317_RS09705 (LB317_09715) | - | 2030097..2030237 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| LB317_RS09710 (LB317_09720) | - | 2030268..2030465 (-) | 198 | WP_001148861.1 | hypothetical protein | - |
| LB317_RS09715 (LB317_09725) | - | 2030481..2031230 (-) | 750 | WP_001148653.1 | phage antirepressor KilAC domain-containing protein | - |
| LB317_RS09720 (LB317_09730) | - | 2031287..2031826 (+) | 540 | WP_000351243.1 | hypothetical protein | - |
| LB317_RS09725 (LB317_09735) | - | 2031850..2032110 (-) | 261 | WP_000435337.1 | hypothetical protein | - |
| LB317_RS09730 (LB317_09740) | - | 2032128..2032352 (-) | 225 | WP_000338186.1 | DUF739 family protein | - |
| LB317_RS09735 (LB317_09745) | - | 2032511..2033281 (+) | 771 | WP_001208482.1 | S24 family peptidase | - |
| LB317_RS09740 (LB317_09750) | - | 2033481..2033663 (+) | 183 | WP_000705240.1 | hypothetical protein | - |
| LB317_RS09745 (LB317_09755) | - | 2033741..2034454 (+) | 714 | WP_001549185.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LB317_RS09750 (LB317_09760) | - | 2034645..2035682 (+) | 1038 | WP_000857198.1 | tyrosine-type recombinase/integrase | - |
| LB317_RS09755 (LB317_09765) | sph | 2035739..2036563 (+) | 825 | Protein_1888 | sphingomyelin phosphodiesterase | - |
| LB317_RS09760 (LB317_09770) | - | 2037138..2038154 (-) | 1017 | WP_031787848.1 | leukocidin/hemolysin toxin family protein | - |
| LB317_RS09765 (LB317_09775) | - | 2038176..2039228 (-) | 1053 | WP_000791422.1 | leukocidin family pore-forming toxin | - |
| LB317_RS09770 (LB317_09780) | - | 2039654..2040877 (+) | 1224 | WP_031787849.1 | ArgE/DapE family deacylase | - |
| LB317_RS09775 (LB317_09785) | - | 2041482..2042789 (+) | 1308 | WP_047451628.1 | TrkH family potassium uptake protein | - |
| LB317_RS09780 (LB317_09790) | - | 2043651..2044094 (-) | 444 | WP_031787852.1 | GNAT family N-acetyltransferase | - |
| LB317_RS09785 (LB317_09795) | - | 2044200..2044636 (-) | 437 | Protein_1894 | hypothetical protein | - |
| LB317_RS09790 (LB317_09800) | - | 2044953..2045543 (-) | 591 | Protein_1895 | terminase small subunit | - |
| LB317_RS09795 (LB317_09805) | - | 2045540..2045701 (-) | 162 | WP_048657541.1 | hypothetical protein | - |
| LB317_RS09800 (LB317_09810) | - | 2045758..2046275 (+) | 518 | Protein_1897 | site-specific integrase | - |
| LB317_RS09805 (LB317_09815) | groL | 2046398..2048014 (-) | 1617 | WP_001118817.1 | chaperonin GroEL | - |
| LB317_RS09810 (LB317_09820) | groES | 2048086..2048370 (-) | 285 | WP_031787855.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17657.52 Da Isoelectric Point: 5.2672
>NTDB_id=608040 LB317_RS09655 WP_000934772.1 2023943..2024413(-) (ssbA) [Staphylococcus argenteus strain 1801221]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=608040 LB317_RS09655 WP_000934772.1 2023943..2024413(-) (ssbA) [Staphylococcus argenteus strain 1801221]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGTACATTTACAAATGCACAAGGCGAGCGCGAGGCAGACTTTATAAATGTCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |