Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   LAZ98_RS13045 Genome accession   NZ_CP083764
Coordinates   2586035..2586472 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain DMB07     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2581035..2591472
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ98_RS12995 (LAZ98_12995) sinI 2581418..2581591 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LAZ98_RS13000 (LAZ98_13000) sinR 2581625..2581960 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LAZ98_RS13005 (LAZ98_13005) tasA 2582008..2582793 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  LAZ98_RS13010 (LAZ98_13010) sipW 2582858..2583442 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LAZ98_RS13015 (LAZ98_13015) tapA 2583414..2584085 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LAZ98_RS13020 (LAZ98_13020) - 2584344..2584673 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LAZ98_RS13025 (LAZ98_13025) - 2584714..2584893 (-) 180 WP_003153093.1 YqzE family protein -
  LAZ98_RS13030 (LAZ98_13030) comGG 2584950..2585327 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  LAZ98_RS13035 (LAZ98_13035) comGF 2585328..2585723 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LAZ98_RS13040 (LAZ98_13040) comGE 2585737..2586051 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LAZ98_RS13045 (LAZ98_13045) comGD 2586035..2586472 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LAZ98_RS13050 (LAZ98_13050) comGC 2586462..2586770 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  LAZ98_RS13055 (LAZ98_13055) comGB 2586775..2587812 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  LAZ98_RS13060 (LAZ98_13060) comGA 2587799..2588869 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  LAZ98_RS13065 (LAZ98_13065) - 2589062..2590012 (-) 951 WP_071181848.1 magnesium transporter CorA family protein -
  LAZ98_RS13070 (LAZ98_13070) - 2590158..2591459 (+) 1302 WP_071181849.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=607833 LAZ98_RS13045 WP_007612572.1 2586035..2586472(-) (comGD) [Bacillus velezensis strain DMB07]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=607833 LAZ98_RS13045 WP_007612572.1 2586035..2586472(-) (comGD) [Bacillus velezensis strain DMB07]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559