Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   LAZ98_RS13040 Genome accession   NZ_CP083764
Coordinates   2585737..2586051 (-) Length   104 a.a.
NCBI ID   WP_017418140.1    Uniprot ID   A0AAP3YC32
Organism   Bacillus velezensis strain DMB07     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2580737..2591051
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ98_RS12995 (LAZ98_12995) sinI 2581418..2581591 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LAZ98_RS13000 (LAZ98_13000) sinR 2581625..2581960 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LAZ98_RS13005 (LAZ98_13005) tasA 2582008..2582793 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  LAZ98_RS13010 (LAZ98_13010) sipW 2582858..2583442 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LAZ98_RS13015 (LAZ98_13015) tapA 2583414..2584085 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LAZ98_RS13020 (LAZ98_13020) - 2584344..2584673 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LAZ98_RS13025 (LAZ98_13025) - 2584714..2584893 (-) 180 WP_003153093.1 YqzE family protein -
  LAZ98_RS13030 (LAZ98_13030) comGG 2584950..2585327 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  LAZ98_RS13035 (LAZ98_13035) comGF 2585328..2585723 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LAZ98_RS13040 (LAZ98_13040) comGE 2585737..2586051 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LAZ98_RS13045 (LAZ98_13045) comGD 2586035..2586472 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LAZ98_RS13050 (LAZ98_13050) comGC 2586462..2586770 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  LAZ98_RS13055 (LAZ98_13055) comGB 2586775..2587812 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  LAZ98_RS13060 (LAZ98_13060) comGA 2587799..2588869 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  LAZ98_RS13065 (LAZ98_13065) - 2589062..2590012 (-) 951 WP_071181848.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11785.77 Da        Isoelectric Point: 5.8181

>NTDB_id=607832 LAZ98_RS13040 WP_017418140.1 2585737..2586051(-) (comGE) [Bacillus velezensis strain DMB07]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADPGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=607832 LAZ98_RS13040 WP_017418140.1 2585737..2586051(-) (comGE) [Bacillus velezensis strain DMB07]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACGCTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGCCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCCCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481