Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   LAZ98_RS12995 Genome accession   NZ_CP083764
Coordinates   2581418..2581591 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain DMB07     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2576418..2586591
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LAZ98_RS12980 (LAZ98_12980) gcvT 2577231..2578331 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  LAZ98_RS12985 (LAZ98_12985) - 2578755..2580425 (+) 1671 WP_017418135.1 DEAD/DEAH box helicase -
  LAZ98_RS12990 (LAZ98_12990) - 2580447..2581241 (+) 795 WP_014305407.1 YqhG family protein -
  LAZ98_RS12995 (LAZ98_12995) sinI 2581418..2581591 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  LAZ98_RS13000 (LAZ98_13000) sinR 2581625..2581960 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LAZ98_RS13005 (LAZ98_13005) tasA 2582008..2582793 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  LAZ98_RS13010 (LAZ98_13010) sipW 2582858..2583442 (-) 585 WP_012117977.1 signal peptidase I SipW -
  LAZ98_RS13015 (LAZ98_13015) tapA 2583414..2584085 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  LAZ98_RS13020 (LAZ98_13020) - 2584344..2584673 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  LAZ98_RS13025 (LAZ98_13025) - 2584714..2584893 (-) 180 WP_003153093.1 YqzE family protein -
  LAZ98_RS13030 (LAZ98_13030) comGG 2584950..2585327 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  LAZ98_RS13035 (LAZ98_13035) comGF 2585328..2585723 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  LAZ98_RS13040 (LAZ98_13040) comGE 2585737..2586051 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  LAZ98_RS13045 (LAZ98_13045) comGD 2586035..2586472 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=607829 LAZ98_RS12995 WP_014418369.1 2581418..2581591(+) (sinI) [Bacillus velezensis strain DMB07]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=607829 LAZ98_RS12995 WP_014418369.1 2581418..2581591(+) (sinI) [Bacillus velezensis strain DMB07]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719